Validation Data Gallery
Tested Applications
Positive WB detected in | HEK-293 cells, HepG2 cells |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human testis tissue, human kidney tissue, human placenta tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells, MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:5000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 27 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
IP | See 4 publications below |
CoIP | See 2 publications below |
Product Information
18137-1-AP targets Importin Alpha 5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12751 Product name: Recombinant human KPNA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 19-272 aa of BC002374 Sequence: LNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQINNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLA 相同性解析による交差性が予測される生物種 |
Full Name | karyopherin alpha 1 (importin alpha 5) |
Calculated molecular weight | 60 kDa |
Observed molecular weight | 60 kDa |
GenBank accession number | BC002374 |
Gene Symbol | Importin Alpha 5 |
Gene ID (NCBI) | 3836 |
RRID | AB_2133553 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P52294 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Importins (alpha and beta) are transport factors that transport proteins into the nucleus. alpha importins function by binding transcription factors at nuclear localization sequences (NLS), and associating with importin beta subunits to translocate through the nuclear pore. Six isoforms of alpha importins have been described in human. Importin alpha 5 is the predominant importin in adult CNS and is essential for differentiation and viability of neural cells.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
IHC protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
IF protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
IP protocol for Importin Alpha 5 antibody 18137-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Acta Pharm Sin B Activated PKB/GSK-3β synergizes with PKC-δ signaling in attenuating myocardial ischemia/reperfusion injury via potentiation of NRF2 activity: Therapeutic efficacy of dihydrotanshinone-I. | ||
Nat Commun Nuclear-capture of endosomes depletes nuclear G-actin to promote SRF/MRTF activation and cancer cell invasion. | ||
Nat Commun CDK5-dependent phosphorylation and nuclear translocation of TRIM59 promotes macroH2A1 ubiquitination and tumorigenicity. | ||
Proc Natl Acad Sci U S A Loss of FCHSD1 leads to amelioration of chronic obstructive pulmonary disease. | ||
PLoS Biol The Transcriptional Activator Krüppel-like Factor-6 Is Required for CNS Myelination.
|