Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
25897-1-AP targets KIF5C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23163 Product name: Recombinant human KIF5C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 143-194 aa of BC110287 Sequence: AVPEDEQISAKDQKNLEPCDNTPIIDNIAPVVAGISTEEKEKYDEEISSLYR 相同性解析による交差性が予測される生物種 |
| Full Name | kinesin family member 5C |
| Calculated molecular weight | 725 aa, 83 kDa |
| Observed molecular weight | 70 kDa, 110 kDa |
| GenBank accession number | BC110287 |
| Gene Symbol | KIF5C |
| Gene ID (NCBI) | 3800 |
| RRID | AB_2880288 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O60282 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
KIF5C (Kinesin heavy chain isoform 5C variant) which belongs to the kinesin-like protein family is neuron specific. The kinesin-1 subfamilies (kif5a, kif5b, kif5c) are responsible for the movement of mitochondria in neurons. Kinesins have N-terminal motor domains and C-terminal cargo-binding tail domains separated by hinge regions. The hinge and C-terminal tail regions of Kif5a, Kif5b, and Kif5c bound a large detergent-resistant RNase-sensitive granule. The granule localized to dendrites and underwent bidirectional movement. Distally directed movement of the granule was enhanced by Kif5 overexpression and reduced by Kif5 functional blockage. kinesins may transport RNA in dendrites via this large granule. Two major isoforms of kif5c, with molecular predicted masses of 80 and 110 kDa, are generated by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIF5C antibody 25897-1-AP | Download protocol |
| IHC protocol for KIF5C antibody 25897-1-AP | Download protocol |
| IP protocol for KIF5C antibody 25897-1-AP | Download protocol |
| WB protocol for KIF5C antibody 25897-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
iScience MFN2 coordinates mitochondria motility with α-tubulin acetylation and this regulation is disrupted in CMT2A | ||
Exp Neurol Axonal injury mediated by neuronal p75NTR/TRAF6/JNK pathway contributes to cognitive impairment after repetitive mTBI | ||
Hum Mol Genet Mitochondrial transport mediates survival of retinal ganglion cells in affected LHON patients. | ||
Alzheimers Res Ther Normal levels of KIF5 but reduced KLC1 levels in both Alzheimer disease and Alzheimer disease in Down syndrome: evidence suggesting defects in anterograde transport. | ||
bioRxiv MFN2-dependent recruitment of ATAT1 coordinates mitochondria motility with alpha-tubulin acetylation and is disrupted in CMT2A | ||
Exp Mol Med Activation of TLR7-mediated autophagy increases epileptic susceptibility via reduced KIF5A-dependent GABAA receptor transport in a murine model |





