Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, mouse lung tissue, MCF-7 cells, MDA-MB-231 cells, NCl-H1299 cells |
| Positive IP detected in | MCF-7 cells, A549 cells |
| Positive FC (Intra) detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
29977-1-AP targets KDM4A in WB, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31992 Product name: Recombinant human KDM4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 584-720 aa of BC002558 Sequence: MFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTPEEEAEETEAWAKPLSQLWQNRPPNFEAEKEFNETMAQQAPHCAVCMIFQTYHQVEFGGFNQNCGNASDLAPQKQRTKPLIPEMCFTSTGCSTDI 相同性解析による交差性が予測される生物種 |
| Full Name | lysine (K)-specific demethylase 4A |
| Calculated molecular weight | 1064 aa, 121 kDa |
| Observed molecular weight | 130-150 kDa |
| GenBank accession number | BC002558 |
| Gene Symbol | KDM4A |
| Gene ID (NCBI) | 9682 |
| RRID | AB_2923625 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75164 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
KDM4A also named as JHDM3A, JMJD2, or KIAA0677 is a 1066 amino acid protein, which contains one JmjC domain, two Tudor domains and two PHD-type zinc fingers. KDM4A localizes in nucleus and belongs to the JHDM3 histone demethylase family. KDM4A is histone de-methylase that specifically demethylates Lys 9 and Lys 36 residues of Histone H3, thereby playing a central role in histone code. JMJD2A demethylation of lysine residues will generate formaldehyde and succinate. KDM4A also participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. JMJD2A is a ubiquitously expressed nuclear protein. KDM4A exists as two isoforms. The short isoform of KDM4A in which the N-terminal demethylase domains has been deleted. The molecular weight of short isoform is 55Da.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for KDM4A antibody 29977-1-AP | Download protocol |
| IP protocol for KDM4A antibody 29977-1-AP | Download protocol |
| WB protocol for KDM4A antibody 29977-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Commun Signal Reversible arginine methylation of PI3KC2α controls mitotic spindle dynamics. | ||
J Environ Sci (China) Carbon black induced pulmonary fibrosis through piR-713551/PIWIL4 targeting THBS2 signal pathway | ||
Biochem Pharmacol SD49-7 attenuates cardiac hypertrophy by upregulation of S100B through KDM4A inhibition | ||
Adv Sci (Weinh) Targeting Intratumoral Copper Inhibits Tumor Progression via p62-Mediated EZH2 Degradation and Potentiates Anti-PD-1 Immunotherapy in Oral Squamous Cell Carcinoma | ||
Chem Biol Drug Des Tetrahydropalmatine Alleviates Osteoarthritis-Associated Pain and Inflammation by Suppressing KDM4A/MDM2/HIF-1α-Mediated M1 Macrophage Polarization. | ||
Front Endocrinol (Lausanne) Deciphering the epigenetic role of KDM4A in pancreatic β-like cell differentiation from iPSCs.
|




