Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, human heart tissue, T-47D cells, mouse heart tissue, rat heart tissue |
| Positive IP detected in | HT-29 cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue, human colon cancer tissue, human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
11146-1-AP targets Gamma Catenin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA 相同性解析による交差性が予測される生物種 |
| Full Name | junction plakoglobin |
| Calculated molecular weight | 82 kDa |
| Observed molecular weight | 82 kDa |
| GenBank accession number | BC011865 |
| Gene Symbol | Gamma Catenin |
| Gene ID (NCBI) | 3728 |
| RRID | AB_2265007 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14923 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| IP protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| WB protocol for Gamma Catenin antibody 11146-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Adv Res OTUD1 delays wound healing by regulating endothelial function and angiogenesis in diabetic mice | ||
J Clin Invest The FOXN3-NEAT1-SIN3A repressor complex promotes progression of hormonally responsive breast cancer. | ||
Oncogene Loss of giant obscurins from breast epithelium promotes epithelial-to-mesenchymal transition, tumorigenicity and metastasis. | ||
PLoS One Quantitative Proteomic Profiling the Molecular Signatures of Annexin A5 in Lung Squamous Carcinoma Cells. | ||
Biochem Biophys Res Commun Plakoglobin is involved in cytoskeletal rearrangement of podocytes under the regulation of UCH-L1. | ||
Biol Reprod Rictor stability mediated by USP9X regulates embryo implantation by participating in lipid metabolism of endometrium |













