Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, K-562 cells, NIH/3T3 cells, rat liver tissue, L02 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse cerebellum tissue, human kidney tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 26 publications below |
| IHC | See 3 publications below |
| IF | See 8 publications below |
| IP | See 2 publications below |
| CoIP | See 3 publications below |
Product Information
10424-1-AP targets JTV1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0675 Product name: Recombinant human JTV1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002853 Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS 相同性解析による交差性が予測される生物種 |
| Full Name | JTV1 gene |
| Calculated molecular weight | 36 kDa |
| Observed molecular weight | 35 kDa |
| GenBank accession number | BC002853 |
| Gene Symbol | JTV1 |
| Gene ID (NCBI) | 7965 |
| RRID | AB_513880 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13155 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
JTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor. This is a rabbit polyclonal antibody raised against full-length of JTV1. There're two isoforms of JTV1 with MW about 27 kDa and 35 kDa,
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for JTV1 antibody 10424-1-AP | Download protocol |
| IHC protocol for JTV1 antibody 10424-1-AP | Download protocol |
| IP protocol for JTV1 antibody 10424-1-AP | Download protocol |
| WB protocol for JTV1 antibody 10424-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cell A methyltransferase-independent role for METTL1 in tRNA aminoacylation and oncogenic transformation | ||
Nat Neurosci Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. | ||
J Exp Clin Cancer Res RNA-binding protein CCDC137 activates AKT signaling and promotes hepatocellular carcinoma through a novel non-canonical role of DGCR8 in mRNA localization | ||
Nat Commun Molecular determinants of selective clearance of protein inclusions by autophagy. | ||
Proc Natl Acad Sci U S A Phosphorylation by the c-Abl protein tyrosine kinase inhibits parkin's ubiquitination and protective function. |














