Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, A549 cells, MCF-7 cells, PC-3 cells, IFN alpha treated A459 cells, HepG2 cells, IFN alpha treated HepG2 cells |
| Positive IHC detected in | human lung cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 11 publications below |
| WB | See 65 publications below |
| IHC | See 13 publications below |
| IF | See 11 publications below |
| IP | See 4 publications below |
| CoIP | See 4 publications below |
| RIP | See 1 publications below |
Product Information
15981-1-AP targets ISG15 in WB, IHC, IF/ICC, IF-P, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, pig, rabbit, monkey, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8782 Product name: Recombinant human ISG15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC009507 Sequence: MGWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGGTEPGGRS 相同性解析による交差性が予測される生物種 |
| Full Name | ISG15 ubiquitin-like modifier |
| Calculated molecular weight | 165 aa, 18 kDa |
| Observed molecular weight | 15-17 kDa |
| GenBank accession number | BC009507 |
| Gene Symbol | ISG15 |
| Gene ID (NCBI) | 9636 |
| RRID | AB_2126302 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P05161 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha (IFNA) and -beta (IFNB). ISG15 forms covalent conjugates with its target proteins in a process called ISGylation, which in mammals is known to play a role in antiviral immunity. ISG15 proteins possess two ubiquitin-like (UBL) domains and a highly conserved C-terminal LRGG sequence, the latter being known as the ubiquitin conjugation motif. Intracellular ISG15 are conjugated, via the LRGG motif, to target proteins through a process called ISGylation, which resembles largely ubiquitination, the process of formation of ubiquitin conjugates. Unconjugated extracellular ISG15, which are released from several types of human and murine cells, are known to possess cytokine-like activity.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ISG15 antibody 15981-1-AP | Download protocol |
| IHC protocol for ISG15 antibody 15981-1-AP | Download protocol |
| WB protocol for ISG15 antibody 15981-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion | ||
Exp Mol Med SIRT1 ISGylation accelerates tumor progression by unleashing SIRT1 from the inactive state to promote its deacetylase activity | ||
Nat Commun Single cell RNA sequencing of human microglia uncovers a subset associated with Alzheimer's disease. | ||
Nat Commun ISGylation controls exosome secretion by promoting lysosomal degradation of MVB proteins. | ||
J Exp Clin Cancer Res ISG15 and ISGylation modulates cancer stem cell-like characteristics in promoting tumor growth of anaplastic thyroid carcinoma
| ||
Cancer Lett Induction of IFIT1/IFIT3 and inhibition of Bcl-2 orchestrate the treatment of myeloma and leukemia via pyroptosis |












