Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse spleen tissue, Jurkat cells, rat spleen tissue |
| Positive IP detected in | mouse spleen tissue |
| Positive IHC detected in | mouse spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 39 publications below |
| IHC | See 10 publications below |
| IF | See 11 publications below |
| ELISA | See 1 publications below |
Product Information
23457-1-AP targets CD126/IL-6R alpha in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18263 Product name: Recombinant human IL-6R protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 22-371 aa of BC132684 Sequence: PRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAG 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 6 receptor |
| Calculated molecular weight | 468 aa, 52 kDa |
| Observed molecular weight | 80 kDa |
| GenBank accession number | BC132684 |
| Gene Symbol | IL-6R alpha |
| Gene ID (NCBI) | 3570 |
| RRID | AB_2827428 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P08887 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Interleukin-6 (IL-6) is a pleiotropic cytokine produced by a variety of cells during infection, trauma, and immunological challenge (PMID: 8274730). IL-6 acts via a receptor complex consisting of two distinct membrane-bound glycoproteins, an 80-kDa IL-6-binding subunit (IL-6R alpha, CD126, gp80) and a 130-kDa signal-transducing element (gp130, CD130). After binding of IL-6 to membrane-bound IL-6R alpha, the complex of IL-6 and IL-6R alpha associates with gp130, thus activating the receptor (PMID: 9716487). Expression of gp130 is found in almost all organs while expression of IL-6R alpha is predominantly confined to hepatocytes and leukocyte subpopulations (monocytes, neutrophils, T cells, and B cells) (PMID: 11149892). Soluble form of IL-6R alpha has been found in human serum and urine (PMID: 2529343; 1545125).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| IP protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| WB protocol for CD126/IL-6R alpha antibody 23457-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms | ||
Cancer Discov Loss of Optineurin Drives Cancer Immune Evasion via Palmitoylation-Dependent IFNGR1 Lysosomal Sorting and Degradation. | ||
J Med Virol Molecular and immune signatures, and pathological trajectories of fatal COVID-19 lungs defined by in situ spatial single-cell transcriptome analysis | ||
BMC Med Molecular landscape of atherosclerotic plaque progression: insights from proteomics, single-cell transcriptomics and genomics | ||
Acta Pharmacol Sin Exosomes derived from induced cardiopulmonary progenitor cells alleviate acute lung injury in mice | ||
Int J Biol Macromol A dual gene-activated dermal scaffolds loaded with nanocomposite particles expressing of VEGF and aFGF: Promoting wound healing by early vascularization |




