Validation Data Gallery
Tested Applications
Recommended dilution
Application | Dilution |
---|---|
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
IF | See 1 publications below |
ELISA | See 1 publications below |
Product Information
16545-1-AP targets IL-4 in WB, IF, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag9871 Product name: Recombinant human IL-4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS 相同性解析による交差性が予測される生物種 |
Full Name | interleukin 4 |
Calculated molecular weight | 153 aa, 17 kDa |
GenBank accession number | BC070123 |
Gene Symbol | IL-4 |
Gene ID (NCBI) | 3565 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P05112 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
What is the molecular weight of IL-4?
IL-4 has a calculated weight of 14.9 kDa.
What cell type produces the IL-4 protein?
Mast cells in peripheral tissues produce the cytokines IL-4 and IL-13, both of which regulate response to environmental allergens. IL-4 in particular is synthesized rapidly following T cell activation to then stimulate downstream anti-inflammatory processes.
What activity does IL-4 stimulate?
IL-4 is a highly polyfunctional cytokine, contributing to the regulation of many cellular and immunological processes. Increases in IL-4 levels stimulate IL-13 production as well as helper T cell and B cell proliferative responses to anti-immunoglobulin antibodies. IL-4 also aids in controlling T helper cell type 2 (Th2) differentiation, driving differentiation of naive T cells to the Th2 pathway.
How do IL-4 levels respond to brain damage?
Ischemic neurons may secrete IL-4 to help decrease proinflammatory activity of macrophages.(PMID: 26269636)
How do IL-4 levels respond to allergens?
Asthmatics express stimulated IL-4 bronchoalveolar lavage during allergen challenges.
Can polymorphisms in the Il4 gene lead to asthma?
Polymorphisms resulting in mutant IL-4 proteins, are associated with asthma risk, development, and severity.
What does the IL-4: IFN-g ratio signify?
IL-4 promotes Th2 differentiation and stability, promoting its own production while inhibiting Th1 cell differentiation. The Th1 pathway, however, produces interferon gamma (IFN-g). The IL-4:IFN-g ratio gives indication as to which pathway is being enhanced or depressed.
PMIDs: 26088754, 26255210, 25819429,10556256
Publications
Species | Application | Title |
---|---|---|
Exp Neurol Photobiomodulation therapy promotes neurogenesis by improving post-stroke local microenvironment and stimulating neuroprogenitor cells. | ||
J Transl Med Immunotherapy landscape analyses of necroptosis characteristics for breast cancer patients. | ||
J Hematol Oncol Ovatodiolide suppresses colon tumorigenesis and prevents polarization of M2 tumor-associated macrophages through YAP oncogenic pathways. | ||
Int J Mol Sci The Human Cytomegalovirus β2.7 Long Non-Coding RNA Prevents Induction of Reactive Oxygen Species to Maintain Viral Gene Silencing during Latency | ||
Surgery Sodium-glucose co-transporter 2 inhibitor canagliflozin modulates myocardial metabolism and inflammation in a swine model for chronic myocardial ischemia | ||
Int Immunopharmacol Radical S-adenosyl methionine domain-containing 2, a potential target of D-tryptophan in asthma treatment, regulates T helper cell type 1/2 balance |