Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, HeLa cells, MOLT-4 cells, RAW 264.7 cells |
| Positive IHC detected in | human oesophagus tissue, human colon tissue, human colon cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
10844-1-AP targets IL-1RA in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1277 Product name: Recombinant human IL-1RA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-159 aa of BC009745 Sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 1 receptor antagonist |
| Calculated molecular weight | 20 kDa |
| Observed molecular weight | 18-20 kDa |
| GenBank accession number | BC009745 |
| Gene Symbol | IL-1RA |
| Gene ID (NCBI) | 3557 |
| RRID | AB_2125559 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P18510 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Interleukin-1 receptor antagonist (IL-1RA) is a critical member of the IL-1 family of cytokines, which plays a significant role in modulating inflammatory responses. IL-1RA exists in two main forms: a secreted form (sIL-1Ra) and an intracellular form (icIL-1Ra). The secreted form is produced by various cells including monocytes, macrophages, neutrophils, and other cells, while the intracellular form is found in keratinocytes and other epithelial cells, as well as in monocytes and fibroblasts. IL-1RA is important in host defense against endotoxin-induced injury and is produced in numerous experimental animal models of disease, as well as in human autoimmune and chronic inflammatory diseases. It acts as an anti-inflammatory agent by maintaining the balance between pro-inflammatory IL-1α/β and its own anti-inflammatory effects.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IL-1RA antibody 10844-1-AP | Download protocol |
| IF protocol for IL-1RA antibody 10844-1-AP | Download protocol |
| IHC protocol for IL-1RA antibody 10844-1-AP | Download protocol |
| WB protocol for IL-1RA antibody 10844-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Oncol Inhibitory effect and mechanism of mesenchymal stem cells on melanoma cells. | ||
NeuroImmune Pharm Ther Resveratrol and its analogs suppress HIV replication, oxidative stress, and inflammation in macrophages | ||
Breast Cancer (Dove Med Press) Identification and Validation of Novel Metastasis-Related Immune Gene Signature in Breast Cancer | ||
Front Immunol The influence of angiopoietin-like protein 3 on macrophages polarization and its effect on the podocyte EMT in diabetic nephropathy |












