Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, Jurkat cells, Raji cells, U-937 cells, MOLT-4 cells, Ramos cells, Daudi cells, HL-60 cells, RAW 264.7 cells |
| Positive IF-P detected in | human tonsillitis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 25 publications below |
| IHC | See 5 publications below |
| IF | See 9 publications below |
Product Information
66148-1-Ig targets IL-17A in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 17A |
| Calculated molecular weight | 155 aa, 18 kDa |
| Observed molecular weight | 18 kDa |
| GenBank accession number | BC067505 |
| Gene Symbol | IL-17A |
| Gene ID (NCBI) | 3605 |
| ENSEMBL Gene ID | ENSG00000112115 |
| RRID | AB_2881544 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16552 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IL-17A antibody 66148-1-Ig | Download protocol |
| IHC protocol for IL-17A antibody 66148-1-Ig | Download protocol |
| WB protocol for IL-17A antibody 66148-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Immunol Potential therapeutic effect of dimethyl fumarate on Treg/Th17 cell imbalance in biliary atresia | ||
Int J Pharm Microneedle system carrying Momordin Ic-loaded ROS-responsive hydrogel ameliorates psoriasis via targeted anti-inflammatory and reactive oxygen species (ROS)-scavenging mechanisms | ||
Mol Nutr Food Res A High MCT-Based Ketogenic Diet Suppresses Th1 and Th17 Responses to Ameliorate Experimental Autoimmune Encephalomyelitis in Mice by Inhibiting GSDMD and JAK2-STAT3/4 Pathways | ||
J Integr Med Ethanol extract of Herpetospermum caudigerum Wall ameliorates psoriasis-like skin inflammation and promotes degradation of keratinocyte-derived ICAM-1 and CXCL9 | ||
Int Immunopharmacol (RS)-bambuterol and its enantiomers: Potential improvement of (R)-bambuterol in mice with colitis. | ||
Int Immunopharmacol IL-17A drives cognitive aging probably via inducing neuroinflammation and theta oscillation disruption in the hippocampus. |





