Validation Data Gallery
Tested Applications
| Positive IHC detected in | human colon cancer tissue, human cervical cancer tissue, human stomach cancer tissue, human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 18 publications below |
| IHC | See 34 publications below |
| IF | See 12 publications below |
| FC | See 1 publications below |
Product Information
13082-1-AP targets IL-17A in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, rabbit |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3733 Product name: Recombinant human IL-17A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-155 aa of BC067505 Sequence: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 17A |
| Calculated molecular weight | 155 aa, 18 kDa |
| GenBank accession number | BC067505 |
| Gene Symbol | IL-17A |
| Gene ID (NCBI) | 3605 |
| ENSEMBL Gene ID | ENSG00000112115 |
| RRID | AB_10644322 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16552 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IL17A, also named as IL-17, is a proinflammatory cytokine. IL-17, synthesized only by memory T cells and natural killer cells, has pleiotropic effects, mainly in the recruitment and activation of neutrophils. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. The IL-17 receptor is a type I transmembrane protein, that is widely expressed on epithelial cells, fibroblasts, B and T cells, and monocytic cells. In psoriatic skin lesions, both Th17 cells and their downstream effector molecules, e.g. IL-17 and IL-22, are highly increased. This antibody got 32-35 kDa band in western blot, maybe due to homodimer formation and differential glycosylations.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IL-17A antibody 13082-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Brain Behav Immun Egln3 expression in microglia enhances the neuroinflammatory responses in Alzheimer's disease | ||
Int J Biol Macromol Chitosan-modified dihydromyricetin liposomes promote the repair of liver injury in mice suffering from diabetes mellitus | ||
J Autoimmun IL-17 is expressed on beta and alpha cells of donors with type 1 and type 2 diabetes. | ||
J Med Chem Discovery of Orally Available Retinoic Acid Receptor-Related Orphan Receptor γ-t/Dihydroorotate Dehydrogenase Dual Inhibitors for the Treatment of Refractory Inflammatory Bowel Disease. | ||
J Invest Dermatol Reduced Il17a expression distinguishes a Ly6c(lo)MHCII(hi) macrophage population promoting wound healing. | ||
Arch Oral Biol Age-related changes of CD4+ T cell migration and cytokine expression in germ-free and SPF mice periodontium. |







