Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, MOLT-4 cells, Raji cells, EL-4-B5 cells, NIH/3T3 cells, mouse liver tissue |
| Positive IHC detected in | mouse spleen tissue, human appendicitis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:300-1:1200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
| CoIP | See 1 publications below |
Product Information
27348-1-AP targets IL-1R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25998 Product name: Recombinant human IL-1R1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-336 aa of BC075063 Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK 相同性解析による交差性が予測される生物種 |
| Full Name | interleukin 1 receptor, type I |
| Calculated molecular weight | 569 aa, 65 kDa |
| Observed molecular weight | 80 kDa, 60 kDa |
| GenBank accession number | BC075063 |
| Gene Symbol | IL1R1 |
| Gene ID (NCBI) | 3554 |
| RRID | AB_3085949 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P14778 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IL-1R1 (IL-1 receptor type 1, also known as p80, IL-1R-alpha or CD121a) is a 80 kDa transmembrane glycoprotein and a member of the interleukin-1 receptor family (PMID: 35163653; 29248002). It is a receptor for IL-1α, IL-1β, and interleukin-1 receptor antagonist (IL-1Ra). IL-1α and IL-1β interact with the extracellular domain of IL-1R1, triggering the recruitment of an accessory receptor, the IL-1RAcP, resulting in a functional receptor complex that initiates IL-1R1 signaling cascades (PMID: 35163653). IL-1Ra competes with active IL-1 and blocks binding to their common activating receptor IL-1R1 and, thus, inhibits IL-1 signaling (PMID: 35332327; 11641511). It has been reported that IL-1R1 may also bind IL-38 (PMID: 29248002). IL-1R1 expression has been found in many cell types including T cells, macrophages, neutrophils, eosinophils, basophils, mast cells, fibroblasts, and endothelial cells. IL-1R1 can be released from the cell surface following proteolytic cleavage, generating a soluble form of 55-60 kDa (PMID: 17324958).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for IL-1R1 antibody 27348-1-AP | Download protocol |
| WB protocol for IL-1R1 antibody 27348-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Exp Gerontol Endoplasmic reticulum stress-induced necroptosis promotes cochlear inflammation: Implications for age-related hearing loss | ||
Cell Signal B4GALT1 drives osteoarthritis progression by stabilizing IL-1R1 through N-linked glycosylation. | ||
Ann Neurol The IL-1β-STING Signaling Axis Drives Neuromyelitis Optica Pathogenesis in a Murine Model. | ||
Int Immunopharmacol VEGF-C silencing unlocks therapeutic synergy between MSCs and dexamethasone for osteoarthritis repair. | ||
J Ethnopharmacol Xiaoyaosan ameliorates stress-induced MASH via modulating IL-1R1/RXRα-mediated liver-brain crosstalk. | ||
Front Neurosci Oxidative stress and inflammation combine to exacerbate cochlear damage and sensorineural hearing loss in C57BL/6 mice |




