Validation Data Gallery
Tested Applications
Positive WB detected in | Human testis, tissue |
Positive IP detected in | PC-3 cells |
Positive IHC detected in | human kidney tissue, human heart tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 4 publications below |
CoIP | See 1 publications below |
Product Information
60227-1-Ig targets IFT88 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4980 Product name: Recombinant human IFT88 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 532-833 aa of BC030776 Sequence: NIGLTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDRGGDKSQAFQYYYESYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECLRFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGERLSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE 相同性解析による交差性が予測される生物種 |
Full Name | intraflagellar transport 88 homolog (Chlamydomonas) |
Calculated molecular weight | 94 kDa |
Observed molecular weight | 88-95 kDa |
GenBank accession number | BC030776 |
Gene Symbol | IFT88 |
Gene ID (NCBI) | 8100 |
RRID | AB_11042449 |
Conjugate | Unconjugated |
Form | |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | Q13099 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Intraflagellar transport (IFT), mediated by molecular motors and IFT particles, is an important transport process that occurs in the cilium and has been shown to be essential for the assembly and maintenance of cilia and flagella in many organisms. IFT88 (intraflagellar transport protein 88; also known as TG737 or TTC10) is a component of IFT particles and required for cilium biogenesis. Defects in IFT88/Tg737 lead to polycystic kidney disease (11062270). IFT88 localizes to spindle poles during mitosis and is required for spindle orientation in mitosis (21441926). This antibody was raised against the C-terminal region of human IFT88 and can detect the endogenous level of IFT88.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for IFT88 antibody 60227-1-Ig | Download protocol |
IHC protocol for IFT88 antibody 60227-1-Ig | Download protocol |
IP protocol for IFT88 antibody 60227-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Physiol Crosstalk between the COX2-PGE2-EP4 signaling pathway and primary cilia in osteoblasts after mechanical stimulation.
| ||
Cell Cycle Chibby functions to preserve normal ciliary morphology through the regulation of intraflagellar transport in airway ciliated cells. | ||
Front Cell Dev Biol Microtubule Stabilization Enhances the Chondrogenesis of Synovial Mesenchymal Stem Cells. | ||
Front Mol Biosci Primary cilia-mediated regulation of microglial secretion in Alzheimer's disease
| ||
J Cell Physiol Ttc39c is upregulated during skeletal muscle atrophy and modulates ERK1/2 MAP kinase and hedgehog signaling. | ||
Molecules 2-IPMA Ameliorates PM2.5-Induced Inflammation by Promoting Primary Ciliogenesis in RPE Cells
|