Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IF | See 4 publications below |
Product Information
10266-1-AP targets IFN-gamma R2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0317 Product name: Recombinant human IFNGR2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 126-324 aa of BC003624 Sequence: WVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIIS 相同性解析による交差性が予測される生物種 |
| Full Name | interferon gamma receptor 2 (interferon gamma transducer 1) |
| Calculated molecular weight | 45 kDa |
| Observed molecular weight | 50-55 kDa |
| GenBank accession number | BC003624 |
| Gene Symbol | IFNGR2 |
| Gene ID (NCBI) | 3460 |
| RRID | AB_2121709 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P38484 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit which attaches to IFN-γ with a significantly lower affinity. Two subunits bind one IFN-γ dimer. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFN-gamma R2 antibody 10266-1-AP | Download protocol |
| IHC protocol for IFN-gamma R2 antibody 10266-1-AP | Download protocol |
| IP protocol for IFN-gamma R2 antibody 10266-1-AP | Download protocol |
| WB protocol for IFN-gamma R2 antibody 10266-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun DENR controls JAK2 translation to induce PD-L1 expression for tumor immune evasion. | ||
Cancer Commun (Lond) MAGE-C3 promotes cancer metastasis by inducing epithelial-mesenchymal transition and immunosuppression in esophageal squamous cell carcinoma. | ||
PLoS One Impact of adipose tissue or umbilical cord derived mesenchymal stem cells on the immunogenicity of human cord blood derived endothelial progenitor cells. | ||
Sci China Life Sci Porcine GWAS identifies ACOT11 as regulator for macrophage IL-1β maturation via IFNGR2 palmitoylation
| ||
Sci Adv Plasma membrane nanodeformations promote actin polymerization through CIP4/CDC42 recruitment and regulate type II IFN signaling |




