Validation Data Gallery
Tested Applications
| Positive WB detected in | U2OS cells, THP-1 cells, HL-60 cells, K-562 cells, Jurkat cells, MCF-7 cells, HeLa cells, LNCaP cells, A549 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 13 publications below |
| IHC | See 1 publications below |
| IF | See 8 publications below |
| IP | See 2 publications below |
| FC | See 1 publications below |
Product Information
66081-1-Ig targets IFITM2/3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17863 Product name: Recombinant human IFITM3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-133 aa of BC006794 Sequence: MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG 相同性解析による交差性が予測される生物種 |
| Full Name | interferon induced transmembrane protein 3 (1-8U) |
| Observed molecular weight | 15-20 kDa |
| GenBank accession number | BC070243 |
| Gene Symbol | IFITM3 |
| Gene ID (NCBI) | 10410 |
| RRID | AB_11182821 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q01628 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IFITM3, also named as interferon-inducible protein 1-8U, belongs to the CD225 family. It is IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, namely influenza A H1N1 virus, West Nile virus (WNV), and dengue virus, by inhibiting the early steps of replication. IFITM3 is identified as interferon-induced cellular proteins that restrict infections by retroviruses and filoviruses and of influenza virus and flaviviruses, respectively. IFITM3, the most potent antiviral IFITM, was found to inhibit an uncharacterized early infectious event after VSV endocytosis, but before primary transcription of its viral genome. IFITM proteins are viral restriction factors that can inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. They differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression. This antibody recognizes both IFITM2 and IFITM3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFITM2/3 antibody 66081-1-Ig | Download protocol |
| IHC protocol for IFITM2/3 antibody 66081-1-Ig | Download protocol |
| WB protocol for IFITM2/3 antibody 66081-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Science IFITM proteins inhibit placental syncytiotrophoblast formation and promote fetal demise. | ||
Nat Commun Omicron Spike confers enhanced infectivity and interferon resistance to SARS-CoV-2 in human nasal tissue | ||
Sci Adv Restriction of HIV-1 infectivity by interferon and IFITM3 is counteracted by Nef. | ||
Proc Natl Acad Sci U S A mTOR inhibitors lower an intrinsic barrier to virus infection mediated by IFITM3. | ||
EMBO J SNARE mimicry by the CD225 domain of IFITM3 enables regulation of homotypic late endosome fusion |



