Validation Data Gallery
Tested Applications
| Positive WB detected in | COLO 320 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:2000-1:8000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 6 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
Product Information
11597-1-AP targets IFI30 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2178 Product name: Recombinant human IFI30 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC021136 Sequence: CSRHTFAPAAMTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK 相同性解析による交差性が予測される生物種 |
| Full Name | interferon, gamma-inducible protein 30 |
| Calculated molecular weight | 261 aa, 29 kDa |
| Observed molecular weight | 29 kDa |
| GenBank accession number | BC021136 |
| Gene Symbol | IFI30 |
| Gene ID (NCBI) | 10437 |
| RRID | AB_2121789 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13284 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IFI30(interferon, gamma-inducible protein 30) is also named as IP30, GILT, IFI-30, MGC32056, IFI30 and belongs to the GILT family. It can facilitate the processing and presentation to antigen-specific T cells of protein antigens containing disulfide bonds. IFI30 is inducibly up-regulated by IFN-g, as are MHC class II molecules, the associated invariant chain, and HLA-DM, which catalyses peptide loading in MIICs and the 35 kDa species is the IFI30 proform, and the 30-kDa species is the mature form(PMID:10639150). It can exsit as a dimer(PMID:17142755).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for IFI30 antibody 11597-1-AP | Download protocol |
| IHC protocol for IFI30 antibody 11597-1-AP | Download protocol |
| IP protocol for IFI30 antibody 11597-1-AP | Download protocol |
| WB protocol for IFI30 antibody 11597-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Med Sci IFI30 expression predicts patient prognosis in breast cancer and dictates breast cancer cells proliferation via regulating autophagy.
| ||
Aging (Albany NY) Identification and validation of a novel signature based on macrophage marker genes for predicting prognosis and drug response in kidney renal clear cell carcinoma by integrated analysis of single cell and bulk RNA sequencing | ||
Cancer Innov Investigating the Mechanism of IFN-γ-Inducible Lysosomal Thiol Reductase-Mediated Inhibition of Breast Cancer Cell Proliferation
| ||
Recent Pat Anticancer Drug Discov The Prognostic Role of Interferon Gamma-inducible Protein 30 in Clear Cell Renal Cell Carcinoma with Immune Infiltrates | ||
Am J Physiol Cell Physiol CFTR and PC2, partners in the primary cilia in autosomal dominant polycystic kidney disease | ||
IUBMB Life Unveiling Gamma-Interferon-Inducible Lysosomal Thiol Reductase (IFI30) as a Regulator of Macrophage Polarization and Prognostic Biomarker by Multi-Transcriptome Analysis in Cervical Cancer |




