Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, mouse heart tissue, mouse skeletal muscle tissue, mouse liver tissue, rat liver tissue, NIH/3T3 cells, SH-SY5Y cells, mouse brain tissue, HepG2 cells, K-562 cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human colon cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 4 publications below |
| WB | See 51 publications below |
| IHC | See 5 publications below |
| IF | See 1 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
15932-1-AP targets IDH2 in WB, IHC, IF, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8779 Product name: Recombinant human IDH2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-452 aa of BC009244 Sequence: TQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ 相同性解析による交差性が予測される生物種 |
| Full Name | isocitrate dehydrogenase 2 (NADP+), mitochondrial |
| Calculated molecular weight | 452 aa, 51 kDa |
| Observed molecular weight | 41-47 kDa |
| GenBank accession number | BC009244 |
| Gene Symbol | IDH2 |
| Gene ID (NCBI) | 3418 |
| RRID | AB_2264612 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48735 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
IDH2, also named as IDP and ICD-M, belongs to the isocitrate and isopropylmalate dehydrogenases family. It plays a role in intermediary metabolism and energy production. IDH2 is a mitochondrial NADP-dependent isocitrate dehydrogenase that catalyzes oxidative decarboxylation of isocitrate to alpha-ketoglutarate, producing NADPH. It may tightly associate or interact with the pyruvate dehydrogenase complex. IDH1 and IDH2 mutations could also contribute to tumorigenesis and cancer progression through increased mutagenesis. IDH2 contains an N-terminal mitochondrial addressing sequence and hence is imported to the mitochondrial matrix, although localization to nuclei has also been reported. Moreover, IDH2, like ~20% of other mitochondrial enzymes, is acetylated at lysines, which inactivates the enzymatic activity.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for IDH2 antibody 15932-1-AP | Download protocol |
| IHC protocol for IDH2 antibody 15932-1-AP | Download protocol |
| IP protocol for IDH2 antibody 15932-1-AP | Download protocol |
| WB protocol for IDH2 antibody 15932-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Res Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2. | ||
Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma | ||
Nat Commun Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1. | ||
Aging Dis Dietary Salt Disrupts Tricarboxylic Acid Cycle and Induces Tau Hyperphosphorylation and Synapse Dysfunction during Aging | ||
Sci Total Environ Protein lysine acetylation played an important role in NH3-induced AEC2 damage and pulmonary fibrosis in piglets | ||
Mol Syst Biol STAT3-dependent analysis reveals PDK4 as independent predictor of recurrence in prostate cancer. |




















