Validation Data Gallery
Tested Applications
| Positive WB detected in | Jurkat cells, HEK-293 cells, mouse brain tissue, RAW 264.7 cells |
| Positive IHC detected in | human breast cancer tissue, mouse spleen tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 3 publications below |
| IHC | See 4 publications below |
| IF | See 2 publications below |
Product Information
10121-2-AP targets ICAM2/CD102 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0165 Product name: Recombinant human ICAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 104-275 aa of BC003097 Sequence: SNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVEPLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAPKMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP 相同性解析による交差性が予測される生物種 |
| Full Name | intercellular adhesion molecule 2 |
| Calculated molecular weight | 31 kDa |
| Observed molecular weight | 55-80 kDa |
| GenBank accession number | BC003097 |
| Gene Symbol | ICAM2/CD102 |
| Gene ID (NCBI) | 3384 |
| RRID | AB_2233415 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13598 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ICAM2 is a cell adhesion protein having important roles in cell migration, especially during inflammation when leukocytes cross the endothelium. Initially described as a receptor for lymphocyte function-associated antigen-1 (LFA1), ICAM2 may play a role in lymphocyte recirculation by blocking LFA-1-dependent cell adhesion. It mediates adhesive interactions important for antigen-specific immune response, NK-cell mediated clearance, lymphocyte recirculation, and other cellular interactions important for immune response and surveillance. ICAM2 has six N-linked glycosylation sites at amino acids (asparagines) 47, 82, 105, 153, 178 and 187. This antibody got 55-80 kDa in western blotting maybe due to glycosylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ICAM2/CD102 antibody 10121-2-AP | Download protocol |
| WB protocol for ICAM2/CD102 antibody 10121-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Cell Infect Microbiol Brain Microvascular Endothelial Cell-Derived HMGB1 Facilitates Monocyte Adhesion and Transmigration to Promote JEV Neuroinvasion. | ||
PLoS One ICAM-2 expression mediates a membrane-actin link, confers a nonmetastatic phenotype and reflects favorable tumor stage or histology in neuroblastoma.
| ||
J Ovarian Res The presence of living endometrial cells in ovarian endometriotic cyst fluid may contribute to the recurrence of endometriosis after surgical excision of endometriomas | ||
Hum Pathol Intercellular adhesion molecule 1/2 and E-selectin in plasma cell mastitis: immunohistochemical study of 35 cases. | ||
Stem Cell Res Ther MSCs promote the efferocytosis of large peritoneal macrophages to eliminate ferroptotic monocytes/macrophages in the injured endometria | ||
Lupus Sci Med Proteomics uncovers ICAM2 (CD102) as a novel serum biomarker of proliferative lupus nephritis
|








