Recombinant human Histone H4 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag8999
Synonyms
H4/j; H4FJ
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
(1-103 aa encoded by BC012587) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |


