Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, NIH/3T3 cells, Raji cells |
| Positive IHC detected in | human lung cancer tissue, human lung tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 17 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
19430-1-AP targets HUWE1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13763 Product name: Recombinant human HUWE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3983-4374 aa of BC002602 Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA 相同性解析による交差性が予測される生物種 |
| Full Name | HECT, UBA and WWE domain containing 1 |
| Calculated molecular weight | 437 aa, 482 kDa |
| Observed molecular weight | 100 kDa, 482 kDa-550 kDa |
| GenBank accession number | BC002602 |
| Gene Symbol | HUWE1 |
| Gene ID (NCBI) | 10075 |
| RRID | AB_2878579 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z6Z7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863). The HUWE1 protein is composed of 4374 amino acids, and its theoretical molecular weight is indeed approximately 480-482 kDa, it is a large protein that is highly susceptible to protease degradation during cell lysis and sample processing. The large fragments (such as those ~250 kDa in size) or smaller fragments produced by degradation will result in bands on the membrane that are lower in position than expected.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HUWE1 antibody 19430-1-AP | Download protocol |
| WB protocol for HUWE1 antibody 19430-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma | ||
Sci Adv Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling.
| ||
FASEB J HUWE1 promotes EGFR ubiquitination and degradation to protect against renal tubulointerstitial fibrosis. | ||
J Cell Sci Derlin-1 promotes ubiquitination and degradation of epithelial sodium channel (ENaC).
| ||
J Cell Sci The role of USP7 in the Shoc2-ERK1/2 signaling axis and Noonan-like syndrome with loose anagen hair.
|















