Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, NIH/3T3 cells, Raji cells |
| Positive IHC detected in | human lung cancer tissue, mouse adrenal gland tissue, mouse stomach tissue, rat brain tissue, rat stomach tissue, human colon cancer tissue, human stomach cancer tissue, human lung tissue, rat adrenal gland tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 5 publications below |
| WB | See 18 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
| IP | See 1 publications below |
Product Information
19430-1-AP targets HUWE1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13763 Product name: Recombinant human HUWE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 3983-4374 aa of BC002602 Sequence: AVLVDYIRVLDFDVKRKYFRQELERLDEGLRKEDMAVHVLRDHVFEDSYRELHRKSPEEMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRIVAKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYHFYQGLVYLLENDVSTLGYDLTFSTEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMRMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTIDIDDLKSNTEYHKYQSNSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESFEKLRHMLLLAIQECSEGFGLA 相同性解析による交差性が予測される生物種 |
| Full Name | HECT, UBA and WWE domain containing 1 |
| Calculated molecular weight | 437 aa, 482 kDa |
| Observed molecular weight | 100 kDa, 482 kDa-550 kDa |
| GenBank accession number | BC002602 |
| Gene Symbol | HUWE1 |
| Gene ID (NCBI) | 10075 |
| RRID | AB_2878579 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7Z6Z7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HUWE1 encodes a HECT domain ubiquitin ligase which is a large protein (500 kDa) has attracted considerable interest because several and quite disparate substrates have been assigned to this E3. It has a role in regulating Berg-mann glia differentiation and this ubiquitin ligase orchestrates the programming of the neural progenitors that give rise to neurons and glia in the cerebellum. HUWE1 is essential for proliferation of a subset of tumor cells, and negative regulator of TP53 during the colorectal carcinoma progression through the ubiquitination pathway mediated by the HECT domain (PMID:15567145). HUWE1 plays a critical role in lung cancer and increased HUWE1 expression is significantly associated with worse prognosis which suggest that HUWE1 might be a potential target for lung cancer therapy (PMID: 30026863). The HUWE1 protein is composed of 4374 amino acids, and its theoretical molecular weight is indeed approximately 480-482 kDa, it is a large protein that is highly susceptible to protease degradation during cell lysis and sample processing. The large fragments (such as those ~250 kDa in size) or smaller fragments produced by degradation will result in bands on the membrane that are lower in position than expected.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HUWE1 antibody 19430-1-AP | Download protocol |
| WB protocol for HUWE1 antibody 19430-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Autophagy Kitasamycin overcomes ferroptosis and immunotherapy resistance by targeting the HUWE1-NCOA4-FTH1 axis. | ||
Nat Commun Overcoming therapeutic resistance in oncolytic herpes virotherapy by targeting IGF2BP3-induced NETosis in malignant glioma | ||
Adv Sci (Weinh) Phosphorylated SHMT2 Regulates Oncogenesis Through m6 A Modification in Lung Adenocarcinoma | ||
Adv Sci (Weinh) REEP1 Accumulation Disrupts ER Integrity and Drives Spinal Motoneuron Degeneration in Distal Hereditary Motor Neuropathy. | ||
Sci Adv Genomic gain of RRS1 promotes hepatocellular carcinoma through reducing the RPL11-MDM2-p53 signaling.
|