Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HAP1 cells, human heart tissue, mouse skeletal muscle tissue, Raji cells, MCF-7 cells, Jurkat cells, HEK-293 cells, SH-SY5Y cells, COS-7 cells, Neuro-2a cells |
| Positive IP detected in | Raji cells |
| Positive IHC detected in | human kidney tissue, human colon tissue, human thyroid tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 18 publications below |
| IHC | See 3 publications below |
| IF | See 4 publications below |
Product Information
15775-1-AP targets HTRA2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.
| Tested Reactivity | human, mouse, rat, monkey |
| Cited Reactivity | human, mouse, rat, monkey, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8455 Product name: Recombinant human HTRA2 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 133-458 aa of BC000096 Sequence: AAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE 相同性解析による交差性が予測される生物種 |
| Full Name | HtrA serine peptidase 2 |
| Calculated molecular weight | 49 kDa |
| Observed molecular weight | 36 kDa |
| GenBank accession number | BC000096 |
| Gene Symbol | HTRA2 |
| Gene ID (NCBI) | 27429 |
| RRID | AB_2122835 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43464 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HTRA2(High temperature requirement protein A2) is also named as OMI, PRSS25 and belongs to the peptidase S1B family. HTRA2 normally exists in the mitochondria, can cause MMP3 activation in the cytosol under a cell stress condition, which can ultimately lead to demise of dopaminergic neuronal cells(PMID: 22265821). It inhibits mitochondrial superoxide generation, stabilizes mitochondrial membrane potential, and prevents apoptosis at baseline and in response to extracellular inducers of mitochondrial stress(PMID: 18772386). This protein has 4 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| IP protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| WB protocol for HTRA2 antibody 15775-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep TIM23 facilitates PINK1 activation by safeguarding against OMA1-mediated degradation in damaged mitochondria | ||
Int J Mol Sci The Mechanism of Mitochondrial Injury in Alpha-1 Antitrypsin Deficiency Mediated Liver Disease. | ||
Hum Mol Genet Multi-OMICS study of a CHCHD10 variant causing ALS demonstrates metabolic rewiring and activation of endoplasmic reticulum and mitochondrial unfolded protein responses. | ||
Cancer Sci Establishment of MAGEC2-knockout cells and functional investigation of MAGEC2 in tumor cells. | ||
Cancer Biomark Role of Smac, survivin, XIAP, and Omi/HtrA2 proteins in determining the chemotherapeutic response of patients with cervical cancer treated with neoadjuvant chemotherapy |













