Validation Data Gallery
Tested Applications
| Positive WB detected in | HCT 116 cells, HeLa cells, HSC-T6 cells, mouse liver tissue, U2OS cells, A549 cells, HepG2 cells, HuH-7 cells |
| Positive IHC detected in | human gliomas tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF detected in | zebrafish retina, MCF-7 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF) | IF : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
Product Information
66767-1-Ig targets HSP27 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27859 Product name: Recombinant human HSPB1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-205 aa of BC012768 Sequence: MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK 相同性解析による交差性が予測される生物種 |
| Full Name | heat shock 27kDa protein 1 |
| Calculated molecular weight | 19-23 kDa |
| Observed molecular weight | 27 kDa |
| GenBank accession number | BC012768 |
| Gene Symbol | HSPB1 |
| Gene ID (NCBI) | 3315 |
| RRID | AB_2882113 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P04792 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HSPB1, also known as heat shock protein 27 (Hsp27), belongs to the small heat shock protein family which is induced in response to environmental challenges or/and developmental transitions. It is also an anti-apoptotic protein that plays crucial roles in tumorigenesis and cell survival and is reported to be an independent prognosis marker for cancer. Recently HSPB1 has been found to be a valuable marker for melanoma. In addition to the predicted 27 kDa, an extra 50-55 kDa representing dimeric form of HSPB1 may also be observed (21353161).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HSP27 antibody 66767-1-Ig | Download protocol |
| IF protocol for HSP27 antibody 66767-1-Ig | Download protocol |
| IHC protocol for HSP27 antibody 66767-1-Ig | Download protocol |
| WB protocol for HSP27 antibody 66767-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Hum Reprod T-cadherin inhibits invasion and migration of endometrial stromal cells in endometriosis. | ||
Oncol Rep SUMOylation of HSP27 regulates PKM2 to promote esophageal squamous cell carcinoma progression. | ||
Int Immunopharmacol Targeting HSPB1 inhibits tumor growth and abrogates Treg-mediated tumor immunosuppression.
| ||
PLoS One Integrated RNA-seq and scRNA-seq to explore the biological mechanisms of mitophagy-related genes in ulcerative colitis. | ||
Cancer Immunol Immunother Integrative analysis of single-cell and bulk transcriptome data reveals age-related immune cell alterations in primary glioblastoma associated with prognosis. |








