Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, A431 cells, HEK-293 cells, HEK-293T cells, K-562 cells, HepG2 cells, NIH/3T3 cells, C6 cells, mouse ovary tissue, mouse testis tissue |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human lung cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 21 publications below |
| IHC | See 2 publications below |
| IF | See 7 publications below |
| IP | See 2 publications below |
| CoIP | See 1 publications below |
| ChIP | See 1 publications below |
Product Information
51034-1-AP targets HSF1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0739 Product name: Recombinant human HSF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 230-529 aa of BC014638 Sequence: SLEHVHGSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS 相同性解析による交差性が予測される生物種 |
| Full Name | heat shock transcription factor 1 |
| Calculated molecular weight | 529 aa, 57 kDa |
| Observed molecular weight | 68-80 kDa |
| GenBank accession number | BC014638 |
| Gene Symbol | HSF1 |
| Gene ID (NCBI) | 3297 |
| RRID | AB_2120269 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00613 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HSF1 belongs to heat-shock transcription factors that activate heat-shock response genes under conditions of heat or other stresses. Also, HSF1 has been linked with oogenesis, spermatogenesis, and placental development. It can activate AKT and inactivate JNK and CASP3 to protect cardiomyocytes from death. And it has a role in the regulation of life span and establishes a role for SIRT1 in protein homeostasis and heat-shock response. The calculated molecular weight of HSF1 is 57 kDa, but HSF1 migrates at approximately 80 kDa which likely represents different phosphorylation states (PMID: 18434628).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HSF1 antibody 51034-1-AP | Download protocol |
| IHC protocol for HSF1 antibody 51034-1-AP | Download protocol |
| IP protocol for HSF1 antibody 51034-1-AP | Download protocol |
| WB protocol for HSF1 antibody 51034-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Spliceosome component Usp39 contributes to hepatic lipid homeostasis through the regulation of autophagy | ||
Dev Cell Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination | ||
Food Funct Protective effects of L-theanine and dihydromyricetin on reproductive function in male mice under heat stress | ||
Int J Pharm Effective myocardial infarction treatment by targeted accumulation of Sulforaphane using porous magnetic silica nanoparticles | ||
Am J Physiol Cell Physiol Cancer associated fibroblasts suppressed ferroptosis in glioblastoma via upregulating lncRNA DLEU1 |










