Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse testis tissue |
| Positive IHC detected in | rat testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
Product Information
15516-1-AP targets HSD3B2 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, canine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7782 Product name: Recombinant human HSD3B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-286 aa of BC038419 Sequence: MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLP 相同性解析による交差性が予測される生物種 |
| Full Name | hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 |
| Calculated molecular weight | 42 kDa |
| Observed molecular weight | 42 kDa |
| GenBank accession number | BC038419 |
| Gene Symbol | HSD3B2 |
| Gene ID (NCBI) | 3284 |
| RRID | AB_2120111 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P26439 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HSD3B2(3-beta-hydroxy-Delta(5)-steroid dehydrogenase) belongs to the 3-beta-HSD family and catalyzes the oxidation and isomerization of delta-5-3-beta-hydroxysteroid precursors into delta-4-ketosteroids, thus leading to the formation of all classes of steroid hormones.HSD3B2 is expressed almost exclusively in adrenals and gonads, whereas HSD3B1 is expressed predominantly in placenta and skin (PMID:1682237). HSD3B2 plays a crucial role in steroid hormone biosynthesis and is thus of particular interest in hormone dependent tumors such as prostate cancer. Compared with normal tissue cytoplasmic HSD3B2 staining was stronger in prostate cancers (PMID: 29803408). Defects in HSD3B2 are the cause of adrenal hyperplasia type 2 (AH2).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HSD3B2 antibody 15516-1-AP | Download protocol |
| IHC protocol for HSD3B2 antibody 15516-1-AP | Download protocol |
| WB protocol for HSD3B2 antibody 15516-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Hazard Mater Tributyltin chloride (TBTCL) induces cell injury via dysregulation of endoplasmic reticulum stress and autophagy in Leydig cells | ||
J Ethnopharmacol Zhuling Yanzong formula ameliorates obesity-induced oligoasthenozoospermia via regulating HSL/StAR and HSL/TIMP-1 | ||
Oncotarget Generation and characteristics of human Sertoli cell line immortalized by overexpression of human telomerase. | ||
Endocrinology A dietary medium-chain fatty acid, decanoic acid, inhibits recruitment of Nur77 to the HSD3B2 promoter in vitro, and reverses endocrine and metabolic abnormalities in a rat model of polycystic ovary syndrome. | ||
Front Physiol Long-Term Maintenance and Meiotic Entry of Early Germ Cells in Murine Testicular Organoids Functionalized by 3D Printed Scaffolds and Air-Medium Interface Cultivation. | ||
Reprod Biomed Online Brain-derived neurotrophic factor expression in granulosa lutein cells. |



