Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse spleen tissue |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 131 publications below |
| IHC | See 8 publications below |
| IF | See 5 publications below |
Product Information
27282-1-AP targets HO-1/HMOX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, chicken, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26172 Product name: Recombinant human HO-1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-288 aa of BC001491 Sequence: AQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM 相同性解析による交差性が予測される生物種 |
| Full Name | heme oxygenase (decycling) 1 |
| Calculated molecular weight | 33 kDa |
| Observed molecular weight | 33 kDa |
| GenBank accession number | BC001491 |
| Gene Symbol | HO-1 |
| Gene ID (NCBI) | 3162 |
| RRID | AB_2880828 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09601 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Heme oxygenase (HMOX1) catalyzes the first and rate-limiting step in the degradation of heme to yield equimolar quantities of biliverdin Ixa, carbon monoxide (CO), and iron. It has 3 isoforms: HO-1 is highly inducible, whereas HO-2 and HO-3 are constitutively expressed (PMID:10194478). Heme oxygenase-1 (HO-1) is expressed in many tissues and vascular smooth muscle cells, and endothelial cells (PMID:15451051) and has been identified as an important endogenous protective factor induced in many cell types by various stimulants, such as hemolysis, infiammatory cytokines,oxidative stress, heat shock, heavy metals, and endotoxin (PMID: 11522663). And the full-length HO-1 is very unstable and susceptible to truncation that generates an inactive, soluble form (28 kDa) (James R. Reed, Pharmacology, 535-568).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for HO-1/HMOX1 antibody 27282-1-AP | Download protocol |
| WB protocol for HO-1/HMOX1 antibody 27282-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Crit Care Recombinant ACE2 protein protects against acute lung injury induced by SARS-CoV-2 spike RBD protein. | ||
Dev Cell Endothelial progenitor cells control remodeling of uterine spiral arteries for the establishment of utero-placental circulation | ||
Microbiome Antioxidant potential of Pediococcus pentosaceus strains from the sow milk bacterial collection in weaned piglets. | ||
ACS Appl Mater Interfaces Thermosensitive Hydrogel Incorporating Prussian Blue Nanoparticles Promotes Diabetic Wound Healing via ROS Scavenging and Mitochondrial Function Restoration. | ||
Free Radic Biol Med Neuroprotective effect of phosphocreatine on oxidative stress and mitochondrial dysfunction induced apoptosis in vitro and in vivo: Involvement of dual PI3K/Akt and Nrf2/HO-1 pathways. | ||
Biomed Pharmacother Qing brick tea (QBT) aqueous extract protects monosodium glutamate-induced obese mice against metabolic syndrome and involves up-regulation Transcription Factor Nuclear Factor-Erythroid 2-Related Factor 2 (Nrf2) antioxidant pathway. |





