Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, Jurkat cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 4 publications below |
| IP | See 2 publications below |
Product Information
16365-1-AP targets HNRNPU in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9151 Product name: Recombinant human HNRNPU protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 462-806 aa of BC003367 Sequence: LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY 相同性解析による交差性が予測される生物種 |
| Full Name | heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A) |
| Calculated molecular weight | 91 kDa |
| Observed molecular weight | 120 kDa |
| GenBank accession number | BC003367 |
| Gene Symbol | HNRNPU |
| Gene ID (NCBI) | 3192 |
| RRID | AB_10596481 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q00839 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HNRNPU, also named as HNRPU, SAFA, and U21.1, is a 825 amino acid protein, which is extensively phosphorylated. HNRNPU as a component of ribonucleosomes localized in cytoplasmic mRNP granules containing untranslated mRNAs. HNRNPU is a component of the CRD-mediated complex that promotes MYC mRNA stabilization. HNRNPU Plays a role in the circadian regulation of the core clock component ARNTL/BMAL1 transcription. The calculated molecular weight of HNRNPU is 90 kDa, but the 120 kDa HNRNPU protein is an abundant nucleoplasmic phosphoprotein that can be crosslinked to pre-mRNA in intact cells by UV light (PMID: 1628625).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HNRNPU antibody 16365-1-AP | Download protocol |
| IF protocol for HNRNPU antibody 16365-1-AP | Download protocol |
| IHC protocol for HNRNPU antibody 16365-1-AP | Download protocol |
| IP protocol for HNRNPU antibody 16365-1-AP | Download protocol |
| WB protocol for HNRNPU antibody 16365-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Dev Cell Genome-wide analysis of pseudogenes reveals HBBP1's human-specific essentiality in erythropoiesis and implication in β-thalassemia. | ||
Cancer Res DIS3L2 promotes progression of hepatocellular carcinoma via hnRNP U-mediated alternative splicing. | ||
mSystems Proteomic Profiling Identifies Kaposi's Sarcoma-Associated Herpesvirus (KSHV)-Encoded LANASIM-Associated Proteins in Hypoxia. | ||
J Exp Clin Cancer Res A novel protein encoded by circHNRNPU promotes multiple myeloma progression by regulating the bone marrow microenvironment and alternative splicing.
| ||
Front Oncol The hnRNPK/A1/R/U Complex Regulates Gene Transcription and Translation and is a Favorable Prognostic Biomarker for Human Colorectal Adenocarcinoma. |








