Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, mouse colon tissue, K-562 cells, Neuro-2a cells, C6 cells |
| Positive IHC detected in | mouse pancreas tissue, human breast cancer tissue, human colon tissue, human colon cancer tissue, human liver cancer tissue, human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 40 publications below |
| IHC | See 4 publications below |
| IF | See 11 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
| RIP | See 1 publications below |
Product Information
11176-1-AP targets HNRNPA1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1656 Product name: Recombinant human HNRNPA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC009600 Sequence: MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGYGGSSSSSSYGSGRRF 相同性解析による交差性が予測される生物種 |
| Full Name | heterogeneous nuclear ribonucleoprotein A1 |
| Calculated molecular weight | 34 kDa |
| Observed molecular weight | 34, 40 kDa |
| GenBank accession number | BC009600 |
| Gene Symbol | HNRNPA1 |
| Gene ID (NCBI) | 3178 |
| RRID | AB_2117177 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09651 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
In eukaryotic cells, nascent RNA polymerase II transcripts are associated in the nucleus with specific proteins to form ribonucleoprotein complexes called HNRP or 40S. Protein moiety of the HNRP particle has 6 major components called core proteins, and HNRPA1 is one of them. hnRNP A1 is a multifunctional RNA binding protein which is involved in pre-mRNA splicing, export of mature transcripts from the nucleus, mRNA turnover, and internal ribosome entry site (IRES)-mediated translation. HNRNPA1 has three isoforms with MW 30 kDa, 34 kDa and 39 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for HNRNPA1 antibody 11176-1-AP | Download protocol |
| IHC protocol for HNRNPA1 antibody 11176-1-AP | Download protocol |
| WB protocol for HNRNPA1 antibody 11176-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell In vivo structural characterization of the SARS-CoV-2 RNA genome identifies host proteins vulnerable to repurposed drugs. | ||
Mol Cell Zc3h13 Regulates Nuclear RNA m6A Methylation and Mouse Embryonic Stem Cell Self-Renewal. | ||
Mol Cell A Peptide Encoded by a Putative lncRNA HOXB-AS3 Suppresses Colon Cancer Growth.
| ||
Nat Commun Profiling PRMT methylome reveals roles of hnRNPA1 arginine methylation in RNA splicing and cell growth.
| ||
Mol Biol Evol Long-term artificial selection reveals a role of TCTP in autophagy in mammalian cells. | ||
J Cell Biol An APEX2 proximity ligation method for mapping interactions with the nuclear lamina. |
















