Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse pancreas tissue, mouse kidney tissue |
| Positive IHC detected in | rat small intestine tissue, mouse small intestine tissue, human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:4000-1:16000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 5 publications below |
| IHC | See 2 publications below |
| IF | See 1 publications below |
| ChIP | See 3 publications below |
Product Information
25801-1-AP targets HNF4G in WB, IHC, IF, chIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22848 Product name: Recombinant human HNF4G protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 327-408 aa of BC105009 Sequence: GGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL 相同性解析による交差性が予測される生物種 |
| Full Name | hepatocyte nuclear factor 4, gamma |
| Calculated molecular weight | 445 aa, 46 kDa |
| Observed molecular weight | 46 kDa |
| GenBank accession number | BC105009 |
| Gene Symbol | HNF4G |
| Gene ID (NCBI) | 3174 |
| RRID | AB_2880242 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q14541 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
HNF4 (hepatocyte nuclear factor 4) is a nuclear receptor protein that has a critical role in hepatocyte differentiation and function (PMID: 12774000). Two isoforms of human HNF4 exist, HNF4-alpha and HNF4-gamma, which are encoded by two separate genes HNF4A and HNF4G respectively (PMID: 7926813). HNF4-gamma has a lower transcription activation potential than HNF4-alpha. HNF4-gamma is expressed in kidney, gut, pancreas, and testis (PMID: 16945327). It has been reported to be involved in cancer progression (PMID: 23896584). This polyclonal antibody is raised against C-terminal 82 amino acids of human HNF4-gamma.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for HNF4G antibody 25801-1-AP | Download protocol |
| IHC protocol for HNF4G antibody 25801-1-AP | Download protocol |
| WB protocol for HNF4G antibody 25801-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Aberrant Activation of a Gastrointestinal Transcriptional Circuit in Prostate Cancer Mediates Castration Resistance. | ||
Protein Cell Metformin inhibits pancreatic cancer metastasis caused by SMAD4 deficiency and consequent HNF4G upregulation. | ||
Eur J Pharmacol Hepatocyte nuclear factor 4 gamma (HNF4G) is correlated with poor prognosis and promotes tumor cell growth by inhibiting caspase-dependent intrinsic apoptosis in colorectal cancer.
| ||
Clin Exp Metastasis Mass spectrometry-based proteomic capture of proteins bound to the MACC1 promoter in colon cancer. | ||
J Transl Med A dynamic molecular landscape in colorectal cancer progression at single-cell resolution | ||
Cell Rep MFGE8 links absorption of dietary fatty acids with catabolism of enterocyte lipid stores through HNF4γ-dependent transcription of CES enzymes
|








