Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse kidney tissue |
| Positive IHC detected in | rat kidney tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 9 publications below |
| IHC | See 7 publications below |
| IF | See 3 publications below |
Product Information
30948-1-AP targets KIM-1/HAVCR1 in WB, IHC, IF-P, ELISA applications and shows reactivity with mouse, rat samples.
| Tested Reactivity | mouse, rat |
| Cited Reactivity | mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Eg0597 Product name: Recombinant Rat KIM-1/HAVCR1 protein (His Tag) Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 18-238 aa of NM_173149.2 Sequence: SVDSYEVVKGVVGHPVTIPCTYSTRGGITTTCWGRGQCPYSSCQNILIWTNGYQVTYRSSGRYNIKGRISEGDVSLTIENSVDSDSGLYCCRVEIPGWFNDQKMTFSLEVKPEIPTSPPTRPTTTRPTTTRPTTISTRSTHVPTSTRVSTSTPTPEQTQTHKPEITTFYAHETTAEVTETPSYTPADWNGTVTSSEEAWNNHTVRIPLRKPQRNPTKGFYV 相同性解析による交差性が予測される生物種 |
| Full Name | hepatitis A virus cellular receptor 1 |
| Calculated molecular weight | 34 kDa |
| Observed molecular weight | 72 kDa |
| GenBank accession number | NM_173149.2 |
| Gene Symbol | Havcr1 |
| Gene ID (NCBI) | 286934 |
| RRID | AB_3669790 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O54947 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Kidney injury molecule 1 (KIM-1), also known as Hepatitis A virus cellular receptor 1 (HAVCR1), CD365, or T-cell immunoglobulin and mucin domain 1 (TIM-1), is a class I integral membrane glycoprotein, with an ectodomain containing Ig-like domain and a mucin domain. KIM-1 acts as a membrane receptor for hepatitis A virus (HAV) (PMID: 9658108; 8861957). KIM-1 provides a costimulatory signal for T cell activation and inhibits the development of peripheral tolerance (PMID: 16284246; 15793575). KIM-1 may be involved in the regulation of asthma and allergic diseases (PMID: 14534576). It has been reported that KIM-1 is shed into urine after acute kidney damage and is a marker of renal tubular injury (PMID: 14600030).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for KIM-1/HAVCR1 antibody 30948-1-AP | Download protocol |
| IHC protocol for KIM-1/HAVCR1 antibody 30948-1-AP | Download protocol |
| WB protocol for KIM-1/HAVCR1 antibody 30948-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol Protective role of vitamin D receptor against mitochondrial calcium overload from PM2.5-Induced injury in renal tubular cells | ||
Sci Total Environ Exploring potential targets and mechanisms of renal tissue damage caused by N-(1,3-dimethylbutyl)-N'-phenyl-p-phenylenediamine quinone (6-PPDQ) through network toxicology and animal experiments: A case of chronic kidney disease | ||
Biol Pharm Bull Nephropathy II Decoction Attenuates Renal Fibrosis via Regulating TLR4 and Gut Microbiota Along the Gut-Kidney Axis | ||
Front Mol Biosci S100A8/A9 high-expression macrophages mediate renal tubular epithelial cell damage in acute kidney injury following acute type A aortic dissection surgery | ||
Int Immunopharmacol Tangeretin protects the kidney from ischemia-reperfusion injury by inhibiting inflammatory response through downregulation of MAOA | ||
Int Immunopharmacol Wogonoside ameliorates oxidative damage in tubular epithelial cells of diabetic nephropathy by modulating the HNF4A-NRF2 axis |






