Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HepG2 cells, PC-3 cells, SKOV-3 cells, Hela cells |
| Positive IHC detected in | human ovary cancer tissue, human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
28130-1-AP targets eRF3a/GSPT1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27963 Product name: Recombinant human GSPT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 294-499 aa of BC009503 Sequence: FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD 相同性解析による交差性が予測される生物種 |
| Full Name | G1 to S phase transition 1 |
| Calculated molecular weight | 68 aa, 4 kDa |
| Observed molecular weight | 80 kDa |
| GenBank accession number | BC009503 |
| Gene Symbol | GSPT1 |
| Gene ID (NCBI) | 2935 |
| RRID | AB_2918149 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15170 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The eukaryotic Release Factor 3 (eRF3) is a GTPase that associates with eRF1 in a complex that mediates translation termination. Eukaryotic release factor 3 (eRF3) has many functions in eukaryotic cells, such as controlling the regulation of the cell cycle at the G1 to S phase transition, and regulating protein synthesis as a GTP dependent stimulator of eRF1 in translation termination. It was also reported to play a key role as an initiator of the mRNA degradation machinery in the recycling of ribosomes in successive cycles of translation,and probably also in transcription regulation. eRF3a, also known as GSPT1, is one subunit of eRF3(PMID:15917414,12923185). It involves in translation termination in response to the termination codons UAA, UAG and UGA and stimulates the activity of ERF1. eRF3a/GSPT1 exists some isoforms with MV 69 kDa and 56 kDa. Identification of a processed form of eRF3a/GSPT1 as a BIR3-binding protein-Using a GST-BIR3 fusion protein as an affinity reagent to purify new IAP binding proteins from extracts of human cells and mouse tissues, we previously isolated 3 proteins of molecular weights 23, 38 and 80 kDa. 80 kDa band confirmed that it is a processed form of the human GSPT1/eRF3a protein, lacking the first 69 residues(PMID: 12865429).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| IHC protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| WB protocol for eRF3a/GSPT1 antibody 28130-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
bioRxiv p300/CBP degradation is required to disable the active AR enhanceosome in prostate cancer | ||
Nat Genet Targeting histone H2B acetylated enhanceosomes via p300/CBP degradation in prostate cancer. |






