Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue, mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 1 publications below |
Product Information
29588-1-AP targets Glutamate receptor 3/GluA3 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30898 Product name: Recombinant human GRIA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 288-425 aa of NM_007325 Sequence: VRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASSENRTI 相同性解析による交差性が予測される生物種 |
| Full Name | glutamate receptor, ionotrophic, AMPA 3 |
| Calculated molecular weight | 101 kDa |
| Observed molecular weight | 101 kDa |
| GenBank accession number | NM_007325 |
| Gene Symbol | GRIA3 |
| Gene ID (NCBI) | 2892 |
| RRID | AB_3086141 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42263 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. GRIA3 (Glutamate ionotropic receptor AMPA type subunit 3), also known as Glutamate receptor R3 or A3 (GluR3 or GluA3), is associated with X-linked intellectual disability (ID), dysmorphic features, and non-syndromic epilepsy(PMID: 32977175). GRIA3 also plays a role as a mediator of tumor progression in pancreatic cancer downstream CUX1(PMID: 20689760).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| IHC protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| IP protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| WB protocol for Glutamate receptor 3/GluA3 antibody 29588-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Discov Postsynaptic lncRNA Sera/Pkm2 pathway orchestrates the transition from social competition to rank by remodeling the neural ensemble in mPFC | ||
J Neurosci Network Dysfunction Precedes Neurodegeneration in a dox-Regulatable TDP-43 Mouse Model of ALS-FTD. | ||
Adv Sci (Weinh) An Anterior Cingulate Cortex-Anterior Insular Cortex Glutamatergic Circuit Gates Stress-Induced Visceral Hypersensitivity and Anxiety via Ionotropic Glutamate Receptors Trafficking. | ||
Mol Psychiatry The dynamic impairment of synaptic transmission in the PCx-IL engram circuit contributes to early olfactory memory decline in Alzheimer's disease. | ||
iScience The decreased astrocyte-microglia interaction reflects the early characteristics of Alzheimer's disease | ||
Front Cardiovasc Med The endogenous glutamatergic transmitter system promotes collagen synthesis in cardiac fibroblasts under hypoxia. |







