Validation Data Gallery
Tested Applications
| Positive WB detected in | U-251 cells, HEK-293 cells | 
| Positive IP detected in | HEK-293 cells | 
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate | 
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 5 publications below | 
| IHC | See 2 publications below | 
| IF | See 1 publications below | 
Product Information
16846-1-AP targets GPX8 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag9930 Product name: Recombinant human GPX8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 38-209 aa of BC029424 Sequence: KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL 相同性解析による交差性が予測される生物種 | 
                                    
| Full Name | glutathione peroxidase 8 (putative) | 
| Calculated molecular weight | 209 aa, 24 kDa | 
| Observed molecular weight | 24 kDa | 
| GenBank accession number | BC029424 | 
| Gene Symbol | GPX8 | 
| Gene ID (NCBI) | 493869 | 
| RRID | AB_2878325 | 
| Conjugate | Unconjugated | 
| Form | |
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q8TED1 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. | 
Background Information
GPX8(Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GPX8 antibody 16846-1-AP | Download protocol | 
| IP protocol for GPX8 antibody 16846-1-AP | Download protocol | 
| WB protocol for GPX8 antibody 16846-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
J Med Virol SARS-CoV-2 nucleocapsid protein enhances the level of mitochondrial reactive oxygen species | ||
Free Radic Biol Med ER-resident antioxidative GPx7 and GPx8 enzyme isoforms protect insulin-secreting INS-1E β-cells against lipotoxicity by improving the ER antioxidative capacity. | ||
Medicina (Kaunas) Chosen Antioxidant Enzymes GPx4 and GPx8 in Human Colorectal Carcinoma: Study of the Slovak Population. | ||
MedComm (2020) Glutathione peroxidase 8 expression on cancer cells and cancer-associated fibroblasts facilitates lung cancer metastasis
  | ||
Int Immunopharmacol Multi-omics study reveals Shuangshen Pingfei formula regulates EETs metabolic reprogramming to exert its therapeutic effect on pulmonary fibrosis | ||
FASEB J Luminal H(2) O(2) promotes ER Ca(2+) dysregulation and toxicity of palmitate in insulin-secreting INS-1E cells | 



