Validation Data Gallery
Tested Applications
| Positive WB detected in | HT-1080 cells, HepG2 cells, LNCaP cells, human placenta tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 14 publications below |
| WB | See 39 publications below |
| IHC | See 7 publications below |
| IF | See 2 publications below |
Product Information
27455-1-AP targets GDF-15 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26760 Product name: Recombinant human GDF15 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 30-308 aa of BC008962 Sequence: LSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI 相同性解析による交差性が予測される生物種 |
| Full Name | growth differentiation factor 15 |
| Calculated molecular weight | 34 kDa |
| Observed molecular weight | 34 kDa |
| GenBank accession number | BC008962 |
| Gene Symbol | GDF15 |
| Gene ID (NCBI) | 9518 |
| RRID | AB_2880875 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99988 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Growth differentiation factor 15 (GDF15), also known as macrophage inhibitory cytokine-1 (MIC-1), is a protein of the transforming growth factor beta (TGFb) superfamily that regulates inflammatory and apoptotic pathways in injured tissues and during disease processes. GDF15 is a stress-induced cytokine and associated with hypoxia, inflammation and oxidative stress, it is also released from endothelial cells after stimulation with pro-inflammatory cytokines. GDF15 has been suggested as a target and biomarker for cardiovascular disease as it plays a cardioprotective role in the adult heart. GDF15 is highly expressed in the placenta. GDF15 is known to be involved in human embryo development and necessary for the maintenance of pregnancy. GDF15 is also produced by adipocytes in response to oxidative stress, a well-known factor associated with preeclampsia.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GDF-15 antibody 27455-1-AP | Download protocol |
| WB protocol for GDF-15 antibody 27455-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Dual functions of SPOP and ERG dictate androgen therapy responses in prostate cancer. | ||
Cancers (Basel) GDF15 Is an Eribulin Response Biomarker also Required for Survival of DTP Breast Cancer Cells.
| ||
Commun Biol Melatonin affects trophoblast epithelial-to-mesenchymal transition and oxidative damage resistance by modulating GDF15 expression to promote embryo implantation | ||
J Cell Physiol Tumor-Derived GDF15 Induces Tumor Associated Fibroblast Transformation From BMSCs and Fibroblasts in Oral Squamous Cell Carcinoma
| ||
Mol Neurobiol Exosomes Derived from Meningitic Escherichia coli-Infected Brain Microvascular Endothelial Cells Facilitate Astrocyte Activation | ||
Antioxidants (Basel) Grape Seed Proanthocyanidins Induce Apoptosis and Cell Cycle Arrest of HepG2 Cells Accompanied by Induction of the MAPK Pathway and NAG-1. |






