Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, mouse liver tissue, K-562 cells, mouse heart tissue, rat heart tissue, HEK-293 cells, rat liver tissue |
| Positive IHC detected in | human lymphoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 9 publications below |
| IHC | See 4 publications below |
| IF | See 5 publications below |
| ChIP | See 2 publications below |
Product Information
11103-1-AP targets GATA2 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1557 Product name: Recombinant human GATA2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 168-467 aa of BC018988 Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG 相同性解析による交差性が予測される生物種 |
| Full Name | GATA binding protein 2 |
| Observed molecular weight | 50-60 kDa |
| GenBank accession number | BC018988 |
| Gene Symbol | GATA2 |
| Gene ID (NCBI) | 2624 |
| ENSEMBL Gene ID | ENSG00000179348 |
| RRID | AB_10914503 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23769 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
What is the molecular weight of GATA2? Is GATA2 post-translationally modified?
The molecular weight of GATA2 is 51 kDa. There are two known isoforms of GATA2 that use alternative first exons (PMID: 10731672). GATA2 can be phosphorylated, which regulates its activity (PMID: 7876160).
What is the subcellular localization of GATA2?
GATA2 acts as a transcription factor in the nucleus. However, it can also be found in the cytoplasm (PMID: 25163535) and its phosphorylation promotes nuclear localization (PMID: 15837948).
What is the tissue expression pattern of GATA2?
GATA2 was initially identified as a hematopoietic transcription factor regulating the differentiation of hematopoietic stem cells but is also present in early erythroid cells, mast cells, and megakaryocytes. Additionally, it is expressed in the central nervous system (PMID: 10357893).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GATA2 antibody 11103-1-AP | Download protocol |
| IHC protocol for GATA2 antibody 11103-1-AP | Download protocol |
| WB protocol for GATA2 antibody 11103-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
EMBO J Functional screen reveals essential roles of miR-27a/24 in differentiation of embryonic stem cells. | ||
BMC Med Downregulation of AC092894.1 promotes oxaliplatin resistance in colorectal cancer via the USP3/AR/RASGRP3 axis | ||
Acta Pharmacol Sin PU.1/Spi1 exacerbates ischemia-reperfusion induced acute kidney injury via upregulating Gata2 and promoting fibroblast activation | ||
PLoS Genet The PU.1-Modulated MicroRNA-22 Is a Regulator of Monocyte/Macrophage Differentiation and Acute Myeloid Leukemia. | ||
Int J Mol Sci LncRNA H19-Derived miR-675-5p Accelerates the Invasion of Extravillous Trophoblast Cells by Inhibiting GATA2 and Subsequently Activating Matrix Metalloproteinases. |










