Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, HL-60 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human gliomas tissue, human colon tissue, human brain (FTLD) tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 8 publications below |
| IHC | See 6 publications below |
| IF | See 8 publications below |
| IP | See 1 publications below |
| RIP | See 1 publications below |
Product Information
60160-1-Ig targets FUS/TLS in WB, IP, IF, RIP, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, Drosophila |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG 相同性解析による交差性が予測される生物種 |
| Full Name | fusion (involved in t(12;16) in malignant liposarcoma) |
| Calculated molecular weight | 75 kDa |
| Observed molecular weight | 68-75 kDa |
| GenBank accession number | BC026062 |
| Gene Symbol | FUS/TLS |
| Gene ID (NCBI) | 2521 |
| RRID | AB_10666169 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35637 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration. Two research groups simultaneously reported that FUS is present in 5% of the pathalogical aggregations (inclusions) seen in familial amyotrophic sclerosis (fALS). FUS-positive inclusions were also reported in cases of sporadic ALS (sALS). More recently, wild-type FUS has also been implicated in the pathological development of frototemporal lobar dementia (FTLD) with ubiquitin-positive inclusions (FTLD-U), further linking FUS to the pathogenesis of neurogenerative diseases. There is some debate as to whether FUS colocalizes with TDP-43 in TDP-43-positive cases of ALS and whether TDP-43 and FUS cause neurodegenerative disease independently or contributively of one another. This antibody is a mouse monoclonal antibody raised against an internal region of human FUS. Initial reports from our customers suggest this new monoclonal FUS antibody (60160-1-Ig) is a useful tool in ALS and FTLD research. For more details, please see our blog article regarding the matter.
Publications
| Species | Application | Title |
|---|---|---|
J Cell Biol The RNA-binding protein Fus directs translation of localized mRNAs in APC-RNP granules.
| ||
Brain Motor neuron degeneration in spastic paraplegia 11 mimics amyotrophic lateral sclerosis lesions. | ||
Acta Neuropathol Transportin 1 accumulates specifically with FET proteins but no other transportin cargos in FTLD-FUS and is absent in FUS inclusions in ALS with FUS mutations. | ||
Cell Rep A Wnt-induced lncRNA-DGCR5 splicing switch drives tumor-promoting inflammation in esophageal squamous cell carcinoma | ||
Acta Neuropathol Commun Topography of FUS pathology distinguishes late-onset BIBD from aFTLD-U. |


















