Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, SH-SY5Y cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | mouse brain tissue, human ovary tumor tissue, rat brain tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse colon tissue, mouse liver tissue |
| Positive IF-Fro detected in | rat brain tissue |
| Positive IF/ICC detected in | HepG2 cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11570-1-AP targets FUS/TLS in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2150 Product name: Recombinant human FUS/TLS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 53-400 aa of BC026062 Sequence: SSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGG 相同性解析による交差性が予測される生物種 |
| Full Name | fusion (involved in t(12;16) in malignant liposarcoma) |
| Calculated molecular weight | 75 kDa |
| Observed molecular weight | 68-75 kDa |
| GenBank accession number | BC026062 |
| Gene Symbol | FUS/TLS |
| Gene ID (NCBI) | 2521 |
| RRID | AB_2247082 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35637 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FUS (also named TLS and POMp75) belongs to the RRM TET family. FUS may play a role in the maintenance of genomic integrity; it binds both single-stranded and double-stranded DNA and promotes ATP-independent annealing of complementary single-stranded DNAs and D-loop formation in superhelical double-stranded DNA. FUS is also an RNA-binding protein, and its links to neurodegenerative disease proffer the intriguing possibility that altered RNA metabolism or RNA processing may underlie or contribute to neuron degeneration[PMID: 22640227]. FUS may be a cause of angiomatoid fibrous histiocytoma (AFH) and is implicated in certain forms of amyotrophic lateral sclerosis (ALS) and frontotemporal dementias (FTDs) such as frontotemporal lobar dementia with ubiquitin inclusions (FTLD-U)[PMID: 22640227]. This antibody is a rabbit polyclonal antibody raised against an internal region of human FUS. FUS was detected double bands of 68-74 kDa (PMID:31519807).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| IHC protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| IP protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| WB protocol for FUS/TLS antibody 11570-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature Mutations in UBQLN2 cause dominant X-linked juvenile and adult-onset ALS and ALS/dementia. | ||
Nat Med Antisense oligonucleotide silencing of FUS expression as a therapeutic approach in amyotrophic lateral sclerosis. | ||
Cell Nuclear-Import Receptors Reverse Aberrant Phase Transitions of RNA-Binding Proteins with Prion-like Domains. | ||
Cell Metab NEAT1 is essential for metabolic changes that promote breast cancer growth and metastasis. | ||
Nat Neurosci FUS-mediated regulation of acetylcholine receptor transcription at neuromuscular junctions is compromised in amyotrophic lateral sclerosis.
|

















