Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, human placenta tissue, mouse lung tissue |
| Positive IP detected in | A549 cells |
| Positive IHC detected in | human renal cell carcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 51 publications below |
| IHC | See 11 publications below |
| IF | See 5 publications below |
| IP | See 2 publications below |
| FC | See 1 publications below |
Product Information
13687-1-AP targets VEGFR-1/FLT-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, bovine, deer |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4558 Product name: Recombinant human VEGFR1, FLT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 21-300 aa of BC039007 Sequence: TGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK 相同性解析による交差性が予測される生物種 |
| Full Name | fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) |
| Calculated molecular weight | 1338 aa, 151 kDa |
| Observed molecular weight | 55-60 kDa |
| GenBank accession number | BC039007 |
| Gene Symbol | VEGFR-1/FLT-1 |
| Gene ID (NCBI) | 2321 |
| RRID | AB_10644337 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17948 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Vascular endothelial growth factor receptor-1 (VEGFR-1, FLT-1) is a receptor tyrosine kinase belonging to the VEGFR family. VEGF is a key regulator of physiological angiogenesis and has also been implicated in pathological angiogenesis associated with tumors, intraocular neovascular disorders, and other conditions. The biological effects of VEGF are mediated by VEGFR-1 and VEGFR-2. Both the two receptors have seven immunoglobulin-like repeats in the extracellular domain, a single transmembrane region and a tyrosine kinase domain. VEGFR-1 binds VEGFA, PIGF, and VEGFB, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. Two isoforms of VEGFR-1 exist, a full-length transmembrane form and a short soluble form (sVEGFR-1) consisting of only the extracellular ligand-binding domain. (PMID: 12778165; 17109193; 8806634)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| IHC protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| IP protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| WB protocol for VEGFR-1/FLT-1 antibody 13687-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Appl Mater Interfaces Biocompatible Chitin Hydrogel Incorporated with PEDOT Nanoparticles for Peripheral Nerve Repair. | ||
Hypertension Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia | ||
Biomed Pharmacother Lychee seed polyphenol ameliorates DR via inhibiting inflammasome/apoptosis and angiogenesis in hRECs and db/db mice | ||
Stem Cells Heparanase released from mesenchymal stem cells activates integrin beta1/HIF-2alpha/Flk-1 signaling and promotes endothelial cell migration and angiogenesis. | ||
J Ethnopharmacol Diterpenoid tanshinones inhibit gastric cancer angiogenesis through the PI3K/Akt/mTOR signaling pathway | ||
Clin Sci (Lond) Anti-anemia drug FG4592 retards the AKI-to-CKD transition by improving vascular regeneration and antioxidative capability. |






