Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, HEK-293 cells, MCF-7 cells, human skeletal muscle tissue, U2OS cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, A431 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 10 publications below |
| IHC | See 3 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
67133-1-Ig targets Filamin A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag23291 Product name: Recombinant human FLNA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 2348-2647 aa of BC014654 Sequence: NQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRVVVP 相同性解析による交差性が予測される生物種 |
| Full Name | filamin A, alpha (actin binding protein 280) |
| Calculated molecular weight | 2647 aa, 280 kDa |
| Observed molecular weight | 280 kDa |
| GenBank accession number | BC014654 |
| Gene Symbol | FLNA |
| Gene ID (NCBI) | 2316 |
| RRID | AB_2882432 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P21333 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FLNA encodes a 280 kDa widely expressed actin binding protein called filamin A which can crosslinks actin filaments and links actin filaments to membrane glycoproteins to form a three-dimensional network (PMID:29931263). And filamin A could interact with many other proteins, involved in receptor activation, cell migration and adhesion, cell proliferation, inflammation and tumorigenesis, studies have been reported that FLNA overexpressed in multiple types of tumors, suggesting FLNA may involved in cancer aggressiveness(PMID:29100390). What's more, FLNA is an causative gene of periventricular nodular heterotopia (PNH) (PMID: 29062687)
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| IHC protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| WB protocol for Filamin A antibody 67133-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Cell Dev Biol NudC L279P Mutation Destabilizes Filamin A by Inhibiting the Hsp90 Chaperoning Pathway and Suppresses Cell Migration. | ||
Hum Mol Genet Expression and subcellular localization of USH1C/harmonin in human retina provides insights into pathomechanisms and therapy | ||
Cancer Res Commun Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles | ||
Mol Med Rep Filamin A regulates EGFR/ERK/Akt signaling and affects colorectal cancer cell growth and migration. | ||
Cell Death Dis NudCL2 regulates cell migration by stabilizing both myosin-9 and LIS1 with Hsp90. | ||
J Exp Clin Cancer Res Focal Adhesion Kinase (FAK)-Hippo/YAP transduction signaling mediates the stimulatory effects exerted by S100A8/A9-RAGE system in triple-negative breast cancer (TNBC). |









