Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, rat testis tissue, mouse testis tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 4 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
Product Information
67874-1-Ig targets FKBP5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, rat, monkey |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5514 Product name: Recombinant human FKBP5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-375 aa of BC042605 Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE 相同性解析による交差性が予測される生物種 |
| Full Name | FK506 binding protein 5 |
| Calculated molecular weight | 457 aa, 51 kDa |
| Observed molecular weight | 51 kDa |
| GenBank accession number | BC042605 |
| Gene Symbol | FKBP5 |
| Gene ID (NCBI) | 2289 |
| RRID | AB_2918632 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13451 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FKBP5, also known as FKBP51, belongs to the family of immunophilins, FK506 binding proteins (FKBPs). FKBP5 is a negative regulator of GR activity and plays a key role in the termination of the stress response by GRs. FKBP5 limits GR function by decreasing ligand-binding sensitivity, thereby delaying nuclear translocation and reducing GR-dependent transcriptional activity. The known functions of FKBP5 include the regulation of steroid hormone receptors, inhibiting apoptosis in cancer cells, promoting Akt1 dephosphorylation, and inhibiting the Akt1 pathways, to name a few. FKBP5 is widely expressed and the calculated molecular weight is 51 kDa (PMID: 21119664, PMID: 34077736, PMID: 37154033).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FKBP5 antibody 67874-1-Ig | Download protocol |
| IHC protocol for FKBP5 antibody 67874-1-Ig | Download protocol |
| WB protocol for FKBP5 antibody 67874-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Free Radic Biol Med Hyperactivation of the m6A demethylase FTO to down-regulate SLC7A11/xCT-mediated redox homeostasis and epigenetic remodeling in facial infiltrating lipomatosis | ||
Int J Mol Sci Chronic Stress Leads to Time-Dependent Bone Loss Through HPA Axis Dysregulation and GR Nuclear Translocation Disorder. | ||
Neurosci Bull Single-Nucleus Transcriptomics of the Nucleus Accumbens Reveals Cell-Type-Specific Dysregulation in Adolescent Macaques with Depressive-Like Behaviors | ||
Stem Cell Res Ther Single-cell sequencing of facial adipose tissue unveils FKBP5 as a therapeutic target for facial infiltrating lipomatosis
| ||
Clin Proteomics Proteomic ratio reveals subtype-specific genetic mechanisms and therapeutic targets in osteoarthritis. |





