Recombinant human FIT1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag24204
Synonyms
MGC46490
Validation Data Gallery
Product Information
| Peptide Sequence |
MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLLQFHVNPRTIFASHGNFFNI
(1-89 aa encoded by BC139911) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
