Validation Data Gallery
Tested Applications
| Positive WB detected in | K-562 cells, mouse ovary tissue |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 10 publications below |
| IHC | See 3 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
11028-2-AP targets FHL3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1495 Product name: Recombinant human FHL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-280 aa of BC011697 Sequence: MSESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP 相同性解析による交差性が予測される生物種 |
| Full Name | four and a half LIM domains 3 |
| Calculated molecular weight | 31 kDa |
| Observed molecular weight | 31-34 kDa |
| GenBank accession number | BC011697 |
| Gene Symbol | FHL3 |
| Gene ID (NCBI) | 2275 |
| RRID | AB_2294066 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13643 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Four and a half LIM domain (FHL) protein 3 is a member of the FHL protein family that has roles in the regulation of signal transduction, survival, cell adhesion, and mobility. It also involves in the development and progression of liver cancer. The FHL proteins have been shown to regulate a variety of transcription factors, including SMAD proteins, β-catenin, SRF, AP-1, NFAT, FOXO1, MyoD, and the androgen receptor. Beside, the FHL proteins may involve in muscle growth and differentiation. Recent research revealed FHL3 was a PCBP2 target, also involved in the growth and induced apoptosis of glioma cell (23585479).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FHL3 antibody 11028-2-AP | Download protocol |
| IP protocol for FHL3 antibody 11028-2-AP | Download protocol |
| WB protocol for FHL3 antibody 11028-2-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun A signature motif in LIM proteins mediates binding to checkpoint proteins and increases tumour radiosensitivity. | ||
Cell Death Differ FHL3 links cell growth and self-renewal by modulating SOX4 in glioma.
| ||
Aging (Albany NY) FHL3 promotes pancreatic cancer invasion and metastasis through preventing the ubiquitination degradation of EMT associated transcription factors.
| ||
J Virol The four and a half LIM family members are novel interactants of the human T-cell leukemia virus type 1 Tax oncoprotein. | ||
Front Oncol FHL3 Contributes to EMT and Chemotherapy Resistance Through Up-Regulation of Slug and Activation of TGFβ/Smad-Independent Pathways in Gastric Cancer. |




