Validation Data Gallery
Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
Product Information
13784-1-AP targets FGF12 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4797 Product name: Recombinant human FGF12 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-181 aa of BC022524 Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST 相同性解析による交差性が予測される生物種 |
| Full Name | fibroblast growth factor 12 |
| Calculated molecular weight | 181 aa, 20 kDa |
| Observed molecular weight | 20-22 kDa |
| GenBank accession number | BC022524 |
| Gene Symbol | FGF12 |
| Gene ID (NCBI) | 2257 |
| RRID | AB_2103928 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P61328 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FGF12 is a member of the FGF family. FGF family members play important roles in embryogenesis, angiogenesis, and wound repair. FGF12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. FGF12 plays an intracellular role in the inhibition of radiation-induced apoptosis. FGF12 is expressed abundantly in developing and adult nervous systems; therefore, FGF12 was thought to be related to nervous system development and function.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for FGF12 antibody 13784-1-AP | Download protocol |
| WB protocol for FGF12 antibody 13784-1-AP | Download protocol |
| IHC protocol for FGF12 antibody 13784-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Neurobiol Dis Decreased expression of synaptic genes in the vestibular ganglion of rodents following subchronic ototoxic stress | ||
Epilepsia Early onset epilepsy and sudden unexpected death in epilepsy with cardiac arrhythmia in mice carrying the early infantile epileptic encephalopathy 47 gain-of-function FHF1(FGF12) missense mutation. | ||
Sci Rep Fibroblast growth factor 12 is expressed in spiral and vestibular ganglia and necessary for auditory and equilibrium function.
| ||
Nat Commun Proximity analysis of native proteomes reveals phenotypic modifiers in a mouse model of autism and related neurodevelopmental conditions | ||
Heliyon Identification of cancer-associated fibroblast-related Ectodysplasin-A as a novel indicator for prognosis and immune response in gastric cancer |



