Validation Data Gallery
Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, MCF-7 cells, mouse brain tissue |
| Positive IHC detected in | human lung cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 10 publications below |
| WB | See 38 publications below |
| IHC | See 9 publications below |
| IF | See 5 publications below |
| IP | See 7 publications below |
Product Information
28424-1-AP targets FBXW7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with Human, Mouse samples.
| Tested Reactivity | Human, Mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28471 Product name: Recombinant human FBXW7 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-227 aa of NM_001349798 Sequence: MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITS 相同性解析による交差性が予測される生物種 |
| Full Name | F-box and WD repeat domain containing 7 |
| Calculated molecular weight | 66 kDa |
| Observed molecular weight | 100-110 kDa, 66-75 kDa |
| GenBank accession number | NM_001349798 |
| Gene Symbol | FBXW7 |
| Gene ID (NCBI) | 55294 |
| RRID | AB_2881138 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969H0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FBXW7, also named as FBW7, FBX30, SEL10 and hAgo, is a substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It probably recognizes and binds to phosphorylated target proteins. FBXW7 is involved in the degradation of cyclin-E, MYC, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1. FBXW7 is a general tumor suppressor in human cancer (PMID: 17909001). FBXW7 has 3 isoforms (α/β/γ) with the calculated molecular mass of 80 kDa, 70 kDa and 66 kDa, and apparent molecular mass of 100-110 kDa and 66-75 kDa (PMID: 31346036/PMID: 22864569). K48 autoubiquitination is consistent with maintenance of ubiquitinated FBW7 (Ub-FBW7, 200 kDa)(PMID: 32353058).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for FBXW7 antibody 28424-1-AP | Download protocol |
| WB protocol for FBXW7 antibody 28424-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Mol Cancer Loss of FBXW7-mediated degradation of BRAF elicits resistance to BET inhibitors in adult T cell leukemia cells. | ||
J Exp Med Somatic gain-of-function mutations in BUD13 promote oncogenesis by disrupting Fbw7 function | ||
Dev Cell Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination
| ||
Cancer Lett Inhibition of KIF20A enhances the immunotherapeutic effect of hepatocellular carcinoma by enhancing c-Myc ubiquitination | ||
Theranostics Histone demethylase JMJD3 protects against renal fibrosis by suppressing TGFβ and Notch signaling and preserving PTEN expression. | ||
EMBO Rep The 18S rRNA m6 A methyltransferase METTL5 promotes mouse embryonic stem cell differentiation. |




