Validation Data Gallery
Tested Applications
| Positive WB detected in | A431 cells, NIH/3T3 cells, HEK-293 cells, HUVEC cells, HeLa cells, Jurkat cells, MCF-7 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | Hepatocellular carcinoma tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HUVEC cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 101 publications below |
| IHC | See 4 publications below |
| IF | See 16 publications below |
| IP | See 1 publications below |
| CoIP | See 3 publications below |
Product Information
12636-1-AP targets FAK in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, monkey, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3331 Product name: Recombinant human FAK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-678 aa of BC028733 Sequence: ITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLKPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQTR 相同性解析による交差性が予測される生物種 |
| Full Name | PTK2 protein tyrosine kinase 2 |
| Calculated molecular weight | 1052 aa, 119 kDa |
| Observed molecular weight | 110 kDa |
| GenBank accession number | BC028733 |
| Gene Symbol | FAK |
| Gene ID (NCBI) | 5747 |
| RRID | AB_2173668 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q05397 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
FAK (Focal adhesion kinase 1) is also named as FAK1, FADK, pp125FAK, FAK and belongs to the protein kinase superfamily. It is a critical tyrosine kinase that modulates cell adhesion, migration, proliferation and survival in response to extracellular signals (PMID:19664602). It also acts as a pivotal signal 'integrator', controlling and coordinating cellular responses that include cell migration, survival, proliferation and, epithelial tissue repair after DNA damage (PMID:20966971). This protein has some isoforms produced by alternative promoter usage and alternative splicing, and the range of the molecular weights are 100-120kD and 40-60kD.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for FAK antibody 12636-1-AP | Download protocol |
| IHC protocol for FAK antibody 12636-1-AP | Download protocol |
| IP protocol for FAK antibody 12636-1-AP | Download protocol |
| WB protocol for FAK antibody 12636-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Gain of miR-151 on chromosome 8q24.3 facilitates tumour cell migration and spreading through downregulating RhoGDIA. | ||
J Exp Clin Cancer Res ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK | ||
Cell Rep Mechanotransduction in response to ECM stiffening impairs cGAS immune signaling in tumor cells | ||
Oncogene KIF26B, a novel oncogene, promotes proliferation and metastasis by activating the VEGF pathway in gastric cancer. |







