Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells |
| Positive IHC detected in | human liver tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 2 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
12551-1-AP targets Factor XII in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3401 Product name: Recombinant human F12 protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 316-615 aa of BC012390 Sequence: MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS 相同性解析による交差性が予測される生物種 |
| Full Name | coagulation factor XII (Hageman factor) |
| Calculated molecular weight | 615 aa, 68 kDa |
| Observed molecular weight | 28-30 kDa |
| GenBank accession number | BC012390 |
| Gene Symbol | Factor XII |
| Gene ID (NCBI) | 2161 |
| RRID | AB_1080025 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P00748 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Factor XII (F XII, Hageman factor) is a 80 kDa, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Factor XII antibody 12551-1-AP | Download protocol |
| WB protocol for Factor XII antibody 12551-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Blood coagulation factor XII drives adaptive immunity during neuroinflammation via CD87-mediated modulation of dendritic cells. | ||
Thyroid Clinical and Molecular Characterizations of Papillary Thyroid Cancer in Children and Young Adults: a Multicenter Retrospective Study. | ||
Int J Mol Med FXII regulates the formation of deep vein thrombosis via the PI3K/AKT signaling pathway in mice.
| ||
Breast Cancer (Dove Med Press) Identification and Validation of Novel Metastasis-Related Immune Gene Signature in Breast Cancer | ||
Environ Sci Technol Maternal PM2.5 Exposure and Cardiac Developmental Abnormalities in Fetuses and Neonates: Progressive Activation of the Complement and Coagulation Cascade | ||
Vet Res TRIM28 regulates the coagulation cascade inhibited by p72 of African swine fever virus
|





