Validation Data Gallery
Tested Applications
| Positive WB detected in | A549 cells, mouse liver tissue |
| Positive IHC detected in | mouse placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IF | See 1 publications below |
Product Information
30847-1-AP targets EGFR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33621 Product name: Recombinant mouse Egfr protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 988-1210 aa of NM_207655 Sequence: RMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQQGFFNSPSTSRTPLLSSLSATSNNSTVACINRNGSCRVKEDAFLQRYSSDPTGAVTEDNIDDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVGNPEYLNTAQPTCLSSGFNSPALWIQKGSHQMSLDNPDYQQDFFPKETKPNGIFKGPTAENAEYLRVAPPSSEFIGA* 相同性解析による交差性が予測される生物種 |
| Full Name | epidermal growth factor receptor |
| Calculated molecular weight | 135 kDa |
| Observed molecular weight | 140-180 kDa |
| GenBank accession number | NM_207655 |
| Gene Symbol | Egfr |
| Gene ID (NCBI) | 13649 |
| RRID | AB_3086421 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q01279 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The epidermal growth factor receptor (EGFR) is a member of the ErbB family of receptor tyrosine kinases (RTKs). Binding of EGFR to epidermal growth factor family ligands triggers a signaling cascade through allosteric activation of epidermal growth factor receptor kinase and trans-autophosphorylation of key tyrosine residues in the tail of the cytoplasmic receptor (PMID: 24691965). Due to phosphorylation, the apparent molecular weight is higher than the calculated molecular weight of 140 kDa. EFGR has been implicated in learning and memory enhancement and pain signaling in mammals (PMID: 20639532 and 35131940).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EGFR antibody 30847-1-AP | Download protocol |
| IHC protocol for EGFR antibody 30847-1-AP | Download protocol |
| WB protocol for EGFR antibody 30847-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS One Evaluation of the mechanism underlying melatonin action in cholestatic liver disease treatment via network pharmacology, molecular docking, and in vivo experiments. | ||
Sci Rep The E3 ubiquitin ligase RNF180 modulates the EGFR/PI3K/AKT pathway to reduce cisplatin resistance in non-small cell lung cancer. | ||
Nan Fang Yi Ke Da Xue Xue Bao Protective effect of Lonicerae Japonicae Flos extract against doxorubicin-induced myocardial injury in mice and the possible mechanisms. | ||
Naunyn Schmiedebergs Arch Pharmacol Citronellol potentiates sunitinib efficacy in renal cell carcinoma by targeting JAK2/STAT3 signaling pathway. | ||
Cell Mol Life Sci Sorcin regulates alveolarization and airway tissue remodeling during lung morphogenesis. | ||
Curr Issues Mol Biol An Integrated Network Pharmacology, Molecular Docking, Molecular Dynamics Simulation, and Experimental Validation Study to Investigate the Potential Mechanism of Isoliquiritigenin in the Treatment of Ischemic Stroke |


