Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, L02 cells |
| Positive IP detected in | L02 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 8 publications below |
| IHC | See 3 publications below |
| IF | See 1 publications below |
| IP | See 2 publications below |
Product Information
21196-1-AP targets EYA3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15544 Product name: Recombinant human EYA3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC029500 Sequence: MEEEQDLPEQPVKKAKMQESGEQTISQVSNPDVSDQKPETSSLASNLPMSEEIMTCTDYIPRSSNDYTSQMYSAKPYAHILSVPVSETAYPGQTQYQTLQQTQPYAVYPQATQTYGLPPFGALWPGMKPESGLIQTPSPSQHSVLTCTTGLTTSQPSPAHYSYPIQASSTNASLISTSSTIANIPAAAVASISNQDYPTYTILGQNQYQACYPSSSFGVTGQTNSDAESTTLAATTYQSEKPSVMAPAPAAQRLSSGDPSTSPSLSQTTPSKDTDDQSRKNMTSKNRGKRKADATSSQDS 相同性解析による交差性が予測される生物種 |
| Full Name | eyes absent homolog 3 (Drosophila) |
| Calculated molecular weight | 573 aa, 63 kDa |
| Observed molecular weight | 63-66 kDa |
| GenBank accession number | BC029500 |
| Gene Symbol | EYA3 |
| Gene ID (NCBI) | 2140 |
| RRID | AB_10732957 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99504 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
EYA3(Eyes absent homolog 3) belongs to the HAD-like hydrolase superfamily.Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis.EYA3, like EYA1, is expressed in the ninth week of human development and may also underlie developmental defects(PMID:9020840).It has 2 isoforms produced by alternative splicing.This antibody is specific to EYA3.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for EYA3 antibody 21196-1-AP | Download protocol |
| IF protocol for EYA3 antibody 21196-1-AP | Download protocol |
| IHC protocol for EYA3 antibody 21196-1-AP | Download protocol |
| IP protocol for EYA3 antibody 21196-1-AP | Download protocol |
| WB protocol for EYA3 antibody 21196-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun The EYA3 tyrosine phosphatase activity promotes pulmonary vascular remodeling in pulmonary arterial hypertension. | ||
Sci Rep WDR1 is a novel EYA3 substrate and its dephosphorylation induces modifications of the cellular actin cytoskeleton. | ||
Sci Rep EYA3 promotes the tumorigenesis of gastric cancer through activation of the mTORC1 signaling pathway and inhibition of autophagy
| ||
Int J Mol Sci Analysis of EYA3 Phosphorylation by Src Kinase Identifies Residues Involved in Cell Proliferation. | ||
PLoS One Structure-Activity Relationships of Benzbromarone Metabolites and Derivatives as EYA Inhibitory Anti-Angiogenic Agents. | ||
Mol Ther Nucleic Acids miR-342-5p downstream to Notch enhances arterialization of endothelial cells in response to shear stress by repressing MYC |










