Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, mouse colon tissue, HuH-7 cells, NCCIT cells, mouse liver tissue, rat liver tissue |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 11 publications below |
| IHC | See 5 publications below |
| IF | See 4 publications below |
| IP | See 1 publications below |
| CoIP | See 1 publications below |
Product Information
22658-1-AP targets EYA1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18489 Product name: Recombinant human EYA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC121799 Sequence: MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGSLNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD 相同性解析による交差性が予測される生物種 |
| Full Name | eyes absent homolog 1 (Drosophila) |
| Calculated molecular weight | 592 aa, 65 kDa |
| Observed molecular weight | 61 kDa and 65 kDa |
| GenBank accession number | BC121799 |
| Gene Symbol | EYA1 |
| Gene ID (NCBI) | 2138 |
| RRID | AB_2879145 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q99502 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
The EYA1 (Eyes absent homolog 1) gene is the human homologue of the Drosophila Eya1 gene, which is essential for eye development in that species. There are 4 different isoforms of EYA1 (EYA1A, EYA1B, EYA1C, EYA1D), which are composed of 559 amino acids (AA), 592 AA, 592 AA and 557 AA, respectively. It should be noted that isoforms B and C have the same length; however, they could be considered different variants because of change in amino acidic composition (PMID: 24803398).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EYA1 antibody 22658-1-AP | Download protocol |
| IHC protocol for EYA1 antibody 22658-1-AP | Download protocol |
| IP protocol for EYA1 antibody 22658-1-AP | Download protocol |
| WB protocol for EYA1 antibody 22658-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Rep YTHDF1 phase separation triggers the fate transition of spermatogonial stem cells by activating the IκB-NF-κB-CCND1 axis | ||
Front Oncol SIX1 Activates STAT3 Signaling to Promote the Proliferation of Thyroid Carcinoma via EYA1. | ||
Oncotarget Eyes absent gene (EYA1) is a pathogenic driver and a therapeutic target for melanoma.
| ||
Stem Cell Res Ther Co-transplantation with adipose-derived cells to improve parathyroid transplantation in a mice model. | ||
Clin Breast Cancer Dachshund 1 is Differentially Expressed Between Male and Female Breast Cancer: A Matched Case-Control Study of Clinical Characteristics and Prognosis. | ||
J Mol Neurosci MES23.5 DA Immortalized Neuroblastoma Cells Self-protect Against Early Injury by Overexpressing Glial Cell-derived Neurotrophic Factor via Akt1/Eya1/Six2 Signaling. |





