Validation Data Gallery
Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, HEK-293 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 6 publications below |
| IF | See 1 publications below |
Product Information
14805-1-AP targets EXOSC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, yeast |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6525 Product name: Recombinant human EXOSC2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC000747 Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG 相同性解析による交差性が予測される生物種 |
| Full Name | exosome component 2 |
| Calculated molecular weight | 33 kDa |
| Observed molecular weight | 30-33 kDa |
| GenBank accession number | BC000747 |
| Gene Symbol | EXOSC2 |
| Gene ID (NCBI) | 23404 |
| RRID | AB_2101837 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13868 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snoRNA and snRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs [PMID:15346807]. EXOSC2 is a non-catalytic component of the RNA exosome complex that has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events [PMID: 17545563].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EXOSC2 antibody 14805-1-AP | Download protocol |
| IHC protocol for EXOSC2 antibody 14805-1-AP | Download protocol |
| IP protocol for EXOSC2 antibody 14805-1-AP | Download protocol |
| WB protocol for EXOSC2 antibody 14805-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Modulated Expression of Specific tRNAs Drives Gene Expression and Cancer Progression. | ||
G3 (Bethesda) Humanized Saccharomyces cerevisiae provides a facile and effective tool to identify damaging human variants that cause exosomopathies | ||
Life Sci Alliance Low expression of EXOSC2 protects against clinical COVID-19 and impedes SARS-CoV-2 replication | ||
Mol Biotechnol EXOSC2 Mediates the Pro-tumor Role of WTAP in Breast Cancer Cells via Activating the Wnt/β-Catenin Signal
|











