Validation Data Gallery
Tested Applications
| Positive WB detected in | HepG2 cells, Jurkat cells, Daudi cells, HSCT6 cells |
| Positive IHC detected in | rat spleen tissue, mouse lung tissue, mouse small intestine tissue, rat lung tissue, rat small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:5000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 7 publications below |
| IHC | See 2 publications below |
| ChIP | See 1 publications below |
Product Information
66598-1-Ig targets ETS1 in WB, IHC, IF/ICC, ChIP, ELISA applications and shows reactivity with human, rat samples.
| Tested Reactivity | human, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2127 Product name: Recombinant human ETS1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-272 aa of BC017314 Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT 相同性解析による交差性が予測される生物種 |
| Full Name | v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
| Calculated molecular weight | 441 aa, 50 kDa |
| Observed molecular weight | 50 kDa |
| GenBank accession number | BC017314 |
| Gene Symbol | ETS1 |
| Gene ID (NCBI) | 2113 |
| RRID | AB_2881958 |
| Conjugate | Unconjugated |
| Form | |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P14921 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol{{ptg:BufferTemp}}7.3 |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
ETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ETS1 antibody 66598-1-Ig | Download protocol |
| IHC protocol for ETS1 antibody 66598-1-Ig | Download protocol |
| WB protocol for ETS1 antibody 66598-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis PLA2G7 promotes immune evasion of bladder cancer through the JAK-STAT-PDL1 axis | ||
Mol Med ets1 associates with KMT5A to participate in high glucose-mediated EndMT via upregulation of PFN2 expression in diabetic nephropathy.
| ||
Blood Adv ETS1 is a novel transcriptional regulator of adult T-cell leukemia/lymphoma of North American descent | ||
Elife Neurons enhance blood-brain barrier function via upregulating claudin-5 and VE-cadherin expression due to glial cell line-derived neurotrophic factor secretion
| ||
Nat Microbiol FEAR antiviral response pathway is independent of interferons and countered by poxvirus proteins | ||
Gene MiR-155-5p facilitates acute lung injury progression via Th17 cells through the ETS-1/STAT3 pathway |














